Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1154 IGR1153 IGR1155 IGR1156 IGR1159 IGR1160 IGR1158 IGR1161 IGR1157 IGR1162 grpE, - NG1422 aarF, - NG1424 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 grpE, - NG1422 aarF, - NG1424 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 grpE, - NG1422 aarF, - NG1424 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 nqrC, - NG1415 nqrC, - NG1415
* Calculated from Protein Sequence

Gene ID: NG1418

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrF  

Definition:
sodium-translocating NADH-ubiquinone reductase subunit F (NqrF)

Gene Start:
1381632

Gene Stop:
1382846

Gene Length:
1215

Molecular Weight*:
45162

pI*:
5.00

Net Charge*:
-14.17

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Ubiquinone biosynthesis

Secondary Evidence:
Beattie,P., Tan,K., Bourne,R.M., Leach,D., Rich,P.R. and Ward,F.B.
Cloning and sequencing of four structural genes for the
Na(+)-translocating NADH-ubiquinone oxidoreductase of Vibrio
alginolyticus.
FEBS Lett. 356 (2-3), 333-338 (1994)
M:95104445

Hase,C.C. and Mekalanos,J.J.
Effects of changes in membrane sodium flux on virulence gene
expression in Vibrio cholerae.
Proc. Natl. Acad. Sci. U.S.A. 96 (6), 3183-3187 (1999)
M:99179036


Comment:
Oklahoma ID: NGO.1418

For subunit sequences, see NG1413-NG1417.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to NqrF chain sequences. Residues 1-405 are 82% similar to the Nqr6 chain in Pasteurella multocida (gb|AAK03417).

Residues 1-405 are virtually identical to NMB0564 in N.meningitidis (gb|AAF40992).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0543
COG name: 2-Octaprenylphenol hydroxylase and related flavodoxin oxidoreductases
Functional Class:  H,C
The phylogenetic pattern of COG0543 is amtKYQV-EbRh-----lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00410 (Phenol hydroxylase reductase family signature) with a combined E-value of 9e-13.
    PR00410B    207-214
    PR00410C    259-268
    PR00410D    274-293
    PR00410E    300-309
    PR00410F    371-379
***** IPB001433 (Oxidoreductase FAD and NAD(P)-binding domain) with a combined E-value of 1.7e-07.
    IPB001433A    275-284
    IPB001433B    371-382


ProDom Summary:  Protein Domain Search
Residues 207-284 are 84% similar to a (REDUCTASE OXIDOREDUCTASE FAD FLAVOPROTEIN NADP HEME NAD) protein domain (PD000183) which is seen in O05012_HAEIN.

Residues 304-404 are 87% similar to a (REDUCTASE OXIDOREDUCTASE FLAVOPROTEIN FAD NAD NITRATE) protein domain (PD011281) which is seen in O05012_HAEIN.

Residues 286-404 are 47% similar to a (UBIQUINONE PHENOLHYDROLASE/NADH OXIDOREDUCTASE HYDROLASE) protein domain (PD160461) which is seen in Q9Z723_BBBBB.

Residues 122-198 are 90% similar to a (UBIQUINONE OXIDOREDUCTASE SUBUNIT PHENOLHYDROLASE/NADH) protein domain (PD037063) which is seen in O05012_HAEIN.

Residues 34-120 are 64% similar to a (IRON-SULFUR FERREDOXIN ELECTRON TRANSPORT CHLOROPLAST) protein domain (PD000232) which is seen in O05012_HAEIN.

Residues 1-44 are 75% similar to a (NADH-UNIQUINONE OXIDOREDUCTASE SUBUNIT F) protein domain (PD164592) which is seen in Q56584_VIBAL.



Paralogs:  Local Blast Search


NG1418 is paralogously related to NG0659 (CDP-6-deoxy-Delta(3,4)-glucoseen reductase) (4e-24) and NG0687 (ferredoxin-NADP reductase) (1e-07).


Pfam Summary:  Pfam Search
Residues 36 to 114 (E-value = 5.3e-12) place NG1418 in the Fer2 family which is described as 2Fe-2S iron-sulfur cluster binding domain (PF00111)
Residues 161 to 265 (E-value = 3.7e-06) place NG1418 in the FAD_binding_6 family which is described as Oxidoreductase FAD-binding domain (PF00970)
Residues 270 to 387 (E-value = 8.9e-25) place NG1418 in the NAD_binding_1 family which is described as Oxidoreductase NAD-binding domain (PF00175)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26
cleavable N-terminal sequence  
1  
26

PDB Hit:
pdb|1KRH|1KRH-A X-RAY STUCTURE OF BENZOATE DIOXYGENASE REDUCTASE 79.2 1e-15
pdb|1GVH|1GVH-A THE X-RAY STRUCTURE OF FERRIC ESCHERICHIA COLI 68.7 2e-12
pdb|1CNF|1CNF NITRATE REDUCTASE (CYTOCHROME B REDUCTASE 63.2 8e-11
pdb|1QFY|1QFY-A PEA

Gene Protein Sequence:
MEIILGIVMFTVIVLALALMILFAKSKLVSEGDITIKVNDEKELTMPAGG
KLLGALASQGIFVPSACGGGGSCGQCRVVVKSGGGDILPTELSHISKREA
REGCRLSCQVNVKTDMDIEVPEEVFGVKKWECTVISNDNKATFIKELKLA
IPEGEEVPFRAGGYIQIEAPPHTVAYKDFDIPKEYHEDWDKYNLWQYVSK
VNEPILRAYSMASYPEEKGIIMLNVRIATPPPRVPNAPPGQMSSYIWSLK
PGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLHSKR
KITFWYGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPLPEDNWDGYTG
FIHNVVYENHLKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENILL
DDFGG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGATTATTTTAGGTATCGTGATGTTTACCGTCATCGTCTTAGCTTT
GGCACTGATGATTCTGTTTGCCAAATCCAAGTTGGTCAGCGAAGGCGACA
TCACCATCAAAGTCAATGATGAAAAAGAACTGACTATGCCCGCCGGCGGC
AAACTCTTGGGCGCGCTTGCCAGCCAAGGCATCTTTGTCCCCTCCGCCTG
CGGTGGCGGCGGTTCGTGCGGACAATGCCGCGTTGTCGTGAAAAGCGGCG
GCGGCGACATTCTGCCGACCGAGCTGTCCCACATCAGCAAACGCGAAGCA
CGCGAAGGCTGCCGTTTGTCCTGCCAAGTCAATGTCAAAACCGACATGGA
CATCGAAGTACCCGAAGAAGTGTTCGGCGTGAAAAAATGGGAATGCACCG
TCATTTCCAACGACAACAAAGCAACGTTCATTAAAGAACTCAAGCTTGCC
ATTCCCGAAGGCGAAGAAGTTCCTTTCCGCGCCGGCGGCTACATTCAAAT
CGAAGCCCCGCCGCACACCGTTGCCTACAAAGACTTCGACATTCCCAAGG
AATATCACGAAGACTGGGACAAATACAATCTGTGGCAATACGTTTCCAAA
GTGAACGAGCCGATTTTGCGCGCCTACTCTATGGCTTCGTATCCTGAAGA
AAAAGGCATCATTATGCTGAACGTGCGTATCGCCACGCCTCCCCCGCGCG
TACCCAATGCACCTCCGGGACAAATGTCGTCCTACATCTGGTCGCTCAAA
CCCGGCGACAAAGTTACGATTTCCGGCCCGTTCGGCGAATTTTTCGCCAA
AGACACCGATGCCGAAATGGTATTTATCGGCGGCGGTGCGGGTATGGCCC
CGATGCGTTCCCACATTTTCGACCAGTTGAAACGTTTGCACTCCAAACGG
AAAATCACCTTCTGGTACGGCGCACGCTCCAAACGCGAAATGTTCTATGT
CGAAGACTTCGACCAACTCGCGGCAGAATTCCCGAACTTCACTTGGCACG
TCGCCCTGTCCGACCCATTGCCTGAAGACAACTGGGACGGCTACACGGGC
TTCATCCACAACGTGGTTTACGAAAACCACCTGAAAAACCACGAAGCACC
GGAAGACTGCGAATTTTATATGTGCGGCCCGCCGATTATGAACCAGTCCG
TCATCAAAATGCTCAAAGACTTGGGCGTGGAAGACGAAAACATCCTCTTG
GACGATTTCGGCGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy