Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1154 IGR1153 IGR1155 IGR1156 IGR1159 IGR1160 IGR1158 IGR1161 IGR1157 IGR1152 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 Type: inverse, Name:  - 179 Type: inverse, Name:  - 181 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 nqrC, - NG1415 nqrC, - NG1415
* Calculated from Protein Sequence

Gene ID: NG1417

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrE  

Definition:
sodium-translocating NADH-ubiquinone reductase subunit E (NqrE)

Gene Start:
1381025

Gene Stop:
1381615

Gene Length:
591

Molecular Weight*:
21166

pI*:
5.90

Net Charge*:
-0.87

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Beattie,P., Tan,K., Bourne,R.M., Leach,D., Rich,P.R. and Ward,F.B.
Cloning and sequencing of four structural genes for the
Na(+)-translocating NADH-ubiquinone oxidoreductase of Vibrio
alginolyticus.
FEBS Lett. 356 (2-3), 333-338 (1994)
M:95104445

Hase,C.C. and Mekalanos,J.J.
Effects of changes in membrane sodium flux on virulence gene
expression in Vibrio cholerae.
Proc. Natl. Acad. Sci. U.S.A. 96 (6), 3183-3187 (1999)
M:99179036


Comment:
Oklahoma ID: NGO.1417

For subunit sequences, see NG1413-NG1416, NG1418.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to NqrE sequences. Residues 1-197 are 80% similar to NqrE in Vibrio cholerae (gb|AAF95435).

Residues 1-197 are virtually identical to NMA0748 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
BeTs to 3 clades of COG2209
COG name: Na+-translocating NADH-quinone oxidoreductase, subunit 5 (NqrE)
Functional Class:  C
The phylogenetic pattern of COG2209 is ------v-e--H------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003667 (RnfA-Nqr electron transport subunit) with a combined E-value of 2e-88.
    IPB003667A    12-44
    IPB003667B    77-129
    IPB003667C    138-168
    IPB003667D    178-186


ProDom Summary:  Protein Domain Search
Residues 1-195 are 79% similar to a (UBIQUINONE REDUCTASE TRANSMEMBRANE) protein domain (PD006282) which is seen in NQRE_HAEIN.



Paralogs:  Local Blast Search


NG1417 is paralogously related to NG1416 (sodium-translocating NADH-ubiquinone reductase subunit D (NqrD)) (2e-13).


Pfam Summary:  Pfam Search
Residues 1 to 197 (E-value = 2.7e-104) place NG1417 in the Rnf-Nqr family which is described as Rnf-Nqr subunit, membrane protein (PF02508)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
16  
32
transmembrane  
37  
53
transmembrane  
74  
90
transmembrane  
112  
128
transmembrane  
143  
159
transmembrane  
174  
190

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLG
LSVPANQLVYSLLKDGAIVEGVDLTFLKFITFIGVIAALVQILEMFLDKF
VPALYNALGIYLPLITVNCAIFGAVSFMAQREYDFGESVVYGFGAGLGWM
LAIVALAGITEKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACACTATTTGAGCCTCTTCATCAAATCCGTCTTCATTGAAAATAT
GGCGCTATCCTTCTTTTTGGGTATGTGTACGTTTTTGGCGGTATCCAAAA
AAGTATCCACCGCATTCGGTTTGGGTGTGGCGGTAATTTTCGTACTCGGG
CTGTCCGTCCCCGCCAACCAATTGGTTTACTCGCTGCTCAAAGACGGCGC
GATTGTCGAAGGCGTGGATTTGACCTTTTTGAAATTCATCACCTTTATCG
GCGTGATTGCCGCTTTGGTGCAGATTTTGGAAATGTTCTTGGACAAATTC
GTCCCCGCCCTCTATAACGCGCTGGGCATCTACCTGCCTCTGATTACCGT
AAACTGCGCAATTTTCGGTGCCGTTTCGTTTATGGCGCAACGCGAATACG
ACTTCGGCGAGTCCGTCGTGTACGGCTTCGGCGCGGGTTTGGGCTGGATG
TTGGCGATTGTCGCTTTAGCGGGCATTACCGAAAAAATGAAATATTCGGA
CGCTCCCAAAGGCCTCAAAGGCTTGGGCATTACCTTTATCGCCGCCGGCC
TGATGGCAATGGCGTTTATGTCGTTCTCCGGCATCCAGTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy