Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1154 IGR1153 IGR1155 IGR1156 IGR1159 IGR1151 IGR1160 IGR1158 IGR1161 IGR1157 IGR1152 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 Type: inverse, Name:  - 179 Type: inverse, Name:  - 181 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 nqrC, - NG1415 nqrC, - NG1415
* Calculated from Protein Sequence

Gene ID: NG1416

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrD  

Definition:
sodium-translocating NADH-ubiquinone reductase subunit D (NqrD)

Gene Start:
1380395

Gene Stop:
1381018

Gene Length:
624

Molecular Weight*:
22685

pI*:
7.20

Net Charge*:
0.13

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Ubiquinone biosynthesis

Secondary Evidence:
Beattie,P., Tan,K., Bourne,R.M., Leach,D., Rich,P.R. and Ward,F.B.
Cloning and sequencing of four structural genes for the
Na(+)-translocating NADH-ubiquinone oxidoreductase of Vibrio
alginolyticus.
FEBS Lett. 356 (2-3), 333-338 (1994)
M:95104445

Hase,C.C. and Mekalanos,J.J.
Effects of changes in membrane sodium flux on virulence gene
expression in Vibrio cholerae.
Proc. Natl. Acad. Sci. U.S.A. 96 (6), 3183-3187 (1999)
M:99179036


Comment:
Oklahoma ID: NGO.1416

For subunit sequences, see NG1413-NG1415, NG1517-NG1418.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to NqrD (Nqr4) sequences. Residues 1-208 are 75% similar to NADH:ubiquinone oxidoreductase, Na translocating enzyme in Haemophilus influenzae (gb|AAC21839).

Residues 1-208 are virtually identical to NMA0749 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1347
COG name: Na+-translocating NADH-quinone reductase, subunit 5
Functional Class:  C
The phylogenetic pattern of COG1347 is ------v-e--H------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003667 (RnfA-Nqr electron transport subunit) with a combined E-value of 3.4e-78.
    IPB003667A    15-47
    IPB003667B    70-122
    IPB003667C    130-160
    IPB003667D    192-200
    IPB003667D    187-195


ProDom Summary:  Protein Domain Search
Residues 8-153 are 76% similar to a (UBIQUINONE REDUCTASE TRANSMEMBRANE) protein domain (PD006282) which is seen in Y168_HAEIN.

Residues 154-207 are 83% similar to a (PROTEIN UNIDENTIFIED OF NA+-TRANSLOCATING) protein domain (PD036369) which is seen in Y168_HAEIN.



Paralogs:  Local Blast Search


NG1416 is paralogously related to NG1417 (sodium-translocating NADH-ubiquinone reductase subunit E (NqrE)) (2e-13).


Pfam Summary:  Pfam Search
Residues 4 to 196 (E-value = 8e-92) place NG1416 in the Rnf-Nqr family which is described as Rnf-Nqr subunit, membrane protein (PF02508)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
36
transmembrane  
46  
62
transmembrane  
70  
86
transmembrane  
100  
116
transmembrane  
179  
195

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVAL
VTGFSSFFISLVRNYIPNSIRIIVQMAIIASLVTLVDQLLQAFAYELSKQ
LSVFVGLIITNCIVMGRAEAFAMKEPPLESLIDGIGNGAGYGMMLLVVAT
VRELIGSGKLLGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRT
WKPEQAEE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGATATGAAACGCTTGAAACATTTGATGTTCTCACCCTTTATCGA
CAACAACCCGATTGCCTTGCAGGTTTTGGGTATTTGTTCGGCTTTGGCGG
TTACCACCAAACTTCAGACGGCCATCGTAATGGGTATTTCCGTAGCTTTG
GTAACCGGTTTTTCCAGCTTCTTCATTTCGCTGGTGCGCAACTACATCCC
CAACAGCATCCGCATCATCGTGCAAATGGCGATTATCGCGTCGCTGGTTA
CGCTGGTCGACCAACTGCTTCAGGCATTTGCCTACGAATTGTCCAAGCAG
CTTTCCGTATTCGTCGGCCTGATTATTACCAACTGTATAGTGATGGGCCG
TGCCGAAGCATTTGCGATGAAAGAGCCGCCGCTGGAAAGCCTGATCGACG
GCATCGGCAACGGTGCGGGCTACGGGATGATGCTGCTTGTCGTCGCCACC
GTCCGCGAACTGATCGGCTCAGGCAAACTTTTAGGTTATACCGTCTTTCA
AACCGTACAGGACGGCGGCTGGTATCAGACCAACGGCCTCTTCCTACTCG
CCCCCAGCGCGTTCTTCATCATCGGCTTTTTGATTTGGGGACTGCGTACT
TGGAAACCCGAACAGGCGGAGGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy