Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1154 IGR1153 IGR1155 IGR1156 IGR1159 IGR1151 IGR1160 IGR1158 IGR1157 IGR1152 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 Type: inverse, Name:  - 179 Type: inverse, Name:  - 181 grpE, - NG1422 tpn, - NG1412 NG1419 NG1421 nqrE, - NG1417 nqrD, - NG1416 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 nqrC, - NG1415 nqrC, - NG1415
* Calculated from Protein Sequence

Gene ID: NG1415

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrC  

Definition:
sodium-translocating NADH-ubiquinone reductase subunit C (NqrC)

Gene Start:
1379619

Gene Stop:
1380392

Gene Length:
774

Molecular Weight*:
27701

pI*:
9.40

Net Charge*:
3.68

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Beattie,P., Tan,K., Bourne,R.M., Leach,D., Rich,P.R. and Ward,F.B.
Cloning and sequencing of four structural genes for the
Na(+)-translocating NADH-ubiquinone oxidoreductase of Vibrio
alginolyticus.
FEBS Lett. 356 (2-3), 333-338 (1994)
M:95104445

Hase,C.C. and Mekalanos,J.J.
Effects of changes in membrane sodium flux on virulence gene
expression in Vibrio cholerae.
Proc. Natl. Acad. Sci. U.S.A. 96 (6), 3183-3187 (1999)
M:99179036


Comment:
Oklahoma ID: NGO.1415

For subunit sequences, see NG1413-NG1414, NG1416-NG1418.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to NqrC (Nqr3) sequences. Residues 6-255 are 54% similar to an unknown in Pasteurella multocida (gb|AAK03414).

Residues 1-258 are virtually identical to NMA0750, a predicted C chain sequence, in N.meningitidis (AL162754).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-254 are 56% similar to a (UBIQUINONE OXIDOREDUCTASE GAMMA NADH SUBUNIT OF) protein domain (PD038728) which is seen in Y167_HAEIN.



Paralogs:  Local Blast Search


NG1415 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 140 to 243 (E-value = 3.2e-39) place NG1415 in the FMN_bind family which is described as FMN-binding domain (PF04205)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
29
cleavable N-terminal sequence  
1  
31
non-globular  
159  
258

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAKKFDKDSFSGTLIVVLAVSLICSVIVAGAVVGLKPIQEKQKLQDKQGY
ILSVAGLMDKDTDIGKTFAERIEQRVVDLATGEYVKDAPKDFSARIAGKD
PAQSIRIKPEDDLAGIKSRAKYTEVYLVKGEDGKIGQIILPMHGNGLWSV
MYGFVAIRPDGNTINGITYYEQGETPGLGGEIGNPLWQQKFVGKKLFDGQ
GKLALHVGKGAGSDKEHGVDALSGASLTSKGVQGSFAYWFGENGYIPYLN
KLKSAGVQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAGAAATTCGATAAAGACAGCTTCAGCGGCACGCTGATTGTCGT
GTTGGCGGTCAGCCTGATTTGCTCGGTCATCGTTGCCGGTGCGGTCGTCG
GCTTGAAACCCATCCAAGAAAAACAAAAACTCCAAGACAAACAAGGCTAT
ATTTTGAGCGTGGCCGGTTTGATGGATAAGGACACCGACATCGGTAAAAC
CTTTGCCGAGCGTATCGAGCAACGCGTGGTCGATTTGGCGACCGGCGAAT
ATGTGAAAGACGCGCCGAAAGACTTCAGCGCGCGCATCGCAGGCAAAGAC
CCCGCGCAAAGCATCCGCATCAAACCTGAAGACGATTTGGCAGGCATCAA
AAGCCGCGCCAAATACACCGAGGTTTATTTGGTAAAAGGCGAAGACGGCA
AAATCGGGCAAATCATCCTGCCGATGCACGGCAACGGTTTGTGGTCGGTG
ATGTACGGCTTCGTCGCCATCCGACCCGACGGCAACACCATCAACGGCAT
TACCTACTACGAACAAGGCGAAACCCCGGGCTTGGGCGGCGAAATCGGCA
ATCCTTTGTGGCAGCAAAAATTCGTCGGCAAAAAATTGTTTGACGGACAA
GGCAAACTCGCCCTGCACGTGGGCAAAGGCGCGGGTTCGGACAAAGAACA
CGGCGTAGACGCCCTCTCCGGCGCGTCGCTGACTTCCAAAGGCGTGCAAG
GTTCGTTCGCCTACTGGTTCGGCGAAAACGGCTATATCCCCTACCTGAAC
AAATTGAAATCAGCAGGAGTGCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy