Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1154 IGR1153 IGR1155 IGR1156 IGR1151 IGR1158 IGR1157 IGR1152 IGR1150 tpn, - NG1412 NG1419 NG1410 nqrE, - NG1417 nqrD, - NG1416 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 tpn, - NG1412 NG1419 NG1410 nqrE, - NG1417 nqrD, - NG1416 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 Type: inverse, Name:  - 179 Type: inverse, Name:  - 181 tpn, - NG1412 NG1419 NG1410 nqrE, - NG1417 nqrD, - NG1416 apbE, - NG1420 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 nqrC, - NG1415 nqrC, - NG1415
* Calculated from Protein Sequence

Gene ID: NG1414

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrB  

Definition:
sodium-translocating NADH-ubiquinone reductase subunit B (NqrB)

Gene Start:
1378394

Gene Stop:
1379623

Gene Length:
1230

Molecular Weight*:
44479

pI*:
9.70

Net Charge*:
5.87

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Beattie,P., Tan,K., Bourne,R.M., Leach,D., Rich,P.R. and Ward,F.B.
Cloning and sequencing of four structural genes for the
Na(+)-translocating NADH-ubiquinone oxidoreductase of Vibrio
alginolyticus.
FEBS Lett. 356 (2-3), 333-338 (1994)
M:95104445

Hase,C.C. and Mekalanos,J.J.
Effects of changes in membrane sodium flux on virulence gene
expression in Vibrio cholerae.
Proc. Natl. Acad. Sci. U.S.A. 96 (6), 3183-3187 (1999)
M:99179036


Comment:
Oklahoma ID: NGO.1414

For subunit sequences, see NG1413, NG1415-NG1418.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to NqrB sequences. Residues 1-407 are 75% similar to the NqrB sequence from Vibrio cholerae (gb|AAF95438).

Residues 1-410 are virtually identical to NMA0751 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1805
COG name: Uncharacterized membrane protein, RnfD family
Functional Class:  S
The phylogenetic pattern of COG1805 is ------vce--H------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 125-367 are 77% similar to a (UBIQUINONE PROTEIN TRANSMEMBRANE NADH DEHYDROGENASE) protein domain (PD014218) which is seen in Q56587_VIBAL.

Residues 371-404 are 94% similar to a (UBIQUINONE OXIDOREDUCTASE NADH DEHYDROGENASE NITROGEN) protein domain (PD041488) which is seen in O05011_HAEIN.

Residues 19-79 are 70% similar to a (UBIQUINONE OXIDOREDUCTASE NADH DEHYDROGENASE NITROGEN) protein domain (PD041489) which is seen in Q56587_VIBAL.



Paralogs:  Local Blast Search


NG1414 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 38 to 404 (E-value = 1.3e-188) place NG1414 in the NQR2_RnfD_RnfE family which is described as NQR2, RnfD, RnfE family (PF03116)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
56  
72
transmembrane  
119  
135
transmembrane  
154  
170
non-globular  
169  
341
transmembrane  
273  
289
transmembrane  
293  
309
transmembrane  
325  
341
transmembrane  
354  
370
transmembrane  
380  
396

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MGLKHFLEKIEPHFLPGGKHEKWYALYEAAATIFYTSGAVTRKAAHVRDA
LDSKRMMILVWLALFPAMFYGMYNVGAQAFGALTPDLLQQSIANDWHYAL
ANALGINMSPEAGVLGKMLFGAIYFLPIYATVFIVGGFWEVLFASVRKHE
INEGFFVTSILFALIVPPTLPLWQAALGISFGVVVAKEVFGGTGKNFMNP
ALAGRAFLFFAYPANLSGDAVWTAVDGYSGATALAQWAAHGADGLKNAVT
GQTITWMDAFIGKLPGSIGEVSTLALLIGGAFIVFARIASWRIIAGVMIG
MIAMSSLFNFIGSDTNAMFAMPWYWHLVVGGFAIGMLFMATDPVSASFTN
VGKWWYGALIGVMCVLIRVANPAYPEGMMLAILFANLFAPIFDYFVAQAN
IKRRKARSNG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCTTAAAACATTTTCTGGAAAAAATCGAACCGCACTTCCTGCCGGG
CGGCAAACATGAAAAATGGTATGCCCTCTATGAAGCTGCGGCGACGATTT
TCTATACATCCGGCGCGGTAACGCGCAAAGCGGCGCACGTCCGCGACGCG
CTCGACTCCAAACGCATGATGATTTTGGTGTGGCTGGCTTTGTTCCCCGC
CATGTTTTACGGCATGTACAACGTCGGCGCACAGGCATTCGGTGCCTTAA
CGCCCGATTTGCTGCAACAAAGCATCGCCAACGACTGGCATTACGCCCTT
GCCAACGCTTTGGGCATCAATATGTCGCCTGAAGCGGGCGTGTTGGGCAA
AATGCTGTTCGGCGCGATTTACTTCCTGCCGATTTACGCGACCGTATTTA
TTGTGGGCGGCTTCTGGGAAGTCTTGTTCGCATCCGTACGCAAACACGAA
ATCAACGAAGGTTTCTTCGTTACTTCGATTCTGTTTGCCTTAATCGTTCC
GCCCACGCTGCCGCTGTGGCAGGCGGCTTTGGGTATTTCTTTCGGCGTTG
TGGTTGCGAAAGAAGTATTCGGCGGTACAGGTAAAAACTTCATGAACCCT
GCGCTGGCAGGCCGCGCCTTCCTGTTCTTCGCCTACCCCGCCAACTTGAG
CGGCGATGCGGTTTGGACGGCGGTTGACGGCTATTCCGGCGCAACCGCGC
TGGCGCAATGGGCGGCACACGGTGCAGACGGCCTGAAAAACGCCGTAACC
GGTCAAACCATCACTTGGATGGACGCGTTTATCGGCAAACTGCCCGGCTC
CATCGGCGAAGTCTCCACTTTGGCACTCTTAATCGGCGGCGCGTTTATCG
TGTTTGCCCGCATCGCTTCTTGGCGCATTATTGCCGGCGTGATGATCGGT
ATGATTGCGATGTCTTCGCTGTTTAACTTCATCGGTTCTGACACCAACGC
TATGTTTGCTATGCCTTGGTACTGGCACTTGGTGGTCGGCGGCTTCGCCA
TCGGTATGCTGTTTATGGCGACCGACCCCGTTTCCGCTTCCTTTACCAAT
GTCGGCAAATGGTGGTACGGCGCGCTTATCGGCGTAATGTGCGTGTTAAT
CCGCGTGGCCAATCCGGCTTACCCCGAAGGCATGATGTTGGCGATTCTGT
TTGCCAACCTGTTTGCCCCGATTTTCGACTATTTCGTCGCACAAGCGAAC
ATCAAACGCAGAAAGGCGCGCAGCAATGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy