Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1154 IGR1153 IGR1155 IGR1156 IGR1149 IGR1151 IGR1152 IGR1150 IGR1148 tpn, - NG1412 NG1410 asnC, - NG1407 nqrE, - NG1417 NG1408 nqrD, - NG1416 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 tpn, - NG1412 NG1410 asnC, - NG1407 nqrE, - NG1417 NG1408 nqrD, - NG1416 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 Type: inverse, Name:  - 179 Type: inverse, Name:  - 181 tpn, - NG1412 asnC, - NG1407 nqrE, - NG1417 NG1408 nqrD, - NG1416 nqrF, - NG1418 nqrB, - NG1414 nqrA, - NG1413 NG1411 nqrC, - NG1415 nqrC, - NG1415 NG1410
* Calculated from Protein Sequence

Gene ID: NG1413

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nqrA  

Definition:
sodium-translocating NADH-ubiquinone reductase subunit A (NqrA)

Gene Start:
1377048

Gene Stop:
1378388

Gene Length:
1341

Molecular Weight*:
48731

pI*:
7.30

Net Charge*:
1.02

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Beattie,P., Tan,K., Bourne,R.M., Leach,D., Rich,P.R. and Ward,F.B.
Cloning and sequencing of four structural genes for the
Na(+)-translocating NADH-ubiquinone oxidoreductase of Vibrio
alginolyticus. FEBS Lett. 356 (2-3), 333-338 (1994)
M:95104445

Hase,C.C. and Mekalanos,J.J.
Effects of changes in membrane sodium flux on virulence gene
expression in Vibrio cholerae. Proc. Natl. Acad. Sci. U.S.A. 96 (6), 3183-3187 (1999)
M:99179036



Comment:
Oklahoma ID: NGO.1413

For subunit sequences, see NG1414-NG1418.

Blast Summary:  PSI-Blast Search
Several matches to outer membrane proteins and sodium-translocating NADH dehydrogenases. Residues 1-447 are 67% similar to an unknown in Pasteurella multocida (gb|AAK03412).

Residues 1-447 are virtually identical to NMA0752 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-447 are 63% similar to a (OXIDOREDUCTASE ALPHA UBIQUINONE) protein domain (PD025201) which is seen in Y164_HAEIN.



Paralogs:  Local Blast Search


NG1413 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
244  
331

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MIKIKKGLNLPIAGRPEQVIYDGPAITEVALLGEEYVGMRPSMKIKEGEA
VKKGQVLFEDKKNPGVVFTAPASGKIAAIHRGEKRVLQSVVIAVEGNDEI
EFERYVPEALAKLSSEKVRRNLIQSGLWTALRTRPFSKIPAVDAEPFAIF
VNAMDTNPLAADPTVIIKEAAEDFKRGLLVLSRLTERKIHVCKAAGADVP
SENAANIETHEFGGPHPAGLSGTHIHFIEPVGANKTVWTINYQDVIAIGR
LFVTGRLNTERVVALGGLQVNKPRLLRTVLGAKVSQLTAGELVDADNRVI
SGSVLNGAIAQGAHDYLGRYHNQISVIEEGRSKELFGWVAPQPDKYSITR
TTLGHFLKNKLFKFTTAVNGGDRAMVPIGTYERVMPLDILPTLLLRDLIV
GDTDSAQALGCLELDEEDLALCSFVCPGKYEYGPLLRKVLETIEKEG

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAAATCAAAAAAGGTCTAAATCTGCCCATCGCGGGCAGACCGGA
GCAAGTCATTTATGACGGCCCGGCCATTACCGAAGTCGCGTTGCTTGGCG
AAGAATATGTCGGCATGCGCCCCTCGATGAAAATCAAGGAAGGTGAAGCC
GTCAAAAAAGGCCAAGTGCTGTTTGAAGACAAAAAGAATCCGGGCGTAGT
ATTTACTGCGCCGGCTTCAGGCAAAATCGCCGCTATTCACCGTGGCGAAA
AGCGCGTACTTCAGTCAGTCGTGATTGCCGTTGAAGGCAACGACGAAATC
GAGTTCGAACGCTACGTACCTGAAGCGCTGGCAAAATTGAGCAGCGAAAA
AGTGCGCCGCAACCTGATTCAATCAGGCTTATGGACTGCGCTTCGCACCC
GTCCGTTCAGCAAAATCCCTGCCGTAGATGCCGAGCCGTTCGCCATCTTC
GTCAATGCGATGGACACCAATCCGCTGGCTGCCGACCCTACGGTCATCAT
CAAAGAAGCCGCCGAAGACTTCAAACGCGGCCTGTTGGTATTGAGCCGCC
TGACCGAACGTAAAATCCATGTGTGTAAAGCAGCAGGCGCAGACGTGCCG
TCTGAAAATGCTGCCAATATCGAAACACATGAATTTGGCGGCCCGCATCC
TGCCGGCTTGAGTGGCACGCACATTCATTTCATCGAGCCAGTCGGCGCGA
ATAAAACCGTGTGGACCATCAATTATCAAGACGTGATTGCTATCGGACGT
TTGTTCGTAACAGGCCGTCTGAATACCGAGCGCGTGGTTGCCTTGGGCGG
CCTGCAAGTCAACAAACCGCGCCTCTTGCGTACCGTTTTGGGTGCGAAGG
TGTCTCAACTTACCGCCGGCGAATTGGTTGACGCGGACAACCGCGTGATT
TCCGGTTCGGTATTGAACGGTGCGATTGCACAAGGCGCGCATGATTATTT
GGGACGCTACCACAATCAGATTTCCGTTATCGAAGAAGGCCGCAGCAAAG
AGCTGTTCGGCTGGGTTGCGCCGCAGCCGGACAAATACTCCATCACGCGC
ACCACTCTCGGCCATTTCCTAAAAAACAAACTCTTCAAGTTCACGACAGC
CGTCAACGGCGGCGACCGCGCCATGGTACCGATCGGCACTTATGAGCGCG
TAATGCCGTTGGACATCCTGCCTACCTTGCTTTTGCGCGATTTAATCGTC
GGCGATACCGACAGCGCGCAGGCTTTGGGTTGCTTGGAATTGGACGAAGA
AGACCTCGCTTTGTGCAGCTTCGTCTGCCCGGGCAAATACGAATACGGCC
CGCTGTTGCGCAAAGTGCTGGAAACCATTGAGAAGGAAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy