Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1144.3 IGR1149 IGR1146 IGR1151 IGR1147 IGR1145 IGR1144.4 IGR1150 IGR1148 gcvH,gcsH, - NG1404 NG1405 tpn, - NG1412 gcvT,gcsT, - NG1406 nosR, - NG1401 nosR, - NG1402 hemA,hem1, - NG1403 NG1410 asnC, - NG1407 NG1408 NG1411 gcvH,gcsH, - NG1404 NG1405 tpn, - NG1412 gcvT,gcsT, - NG1406 nosR, - NG1401 nosR, - NG1402 hemA,hem1, - NG1403 NG1410 asnC, - NG1407 NG1408 NG1411 Type: inverse, Name:  - 179 Type: inverse, Name:  - 181 gcvH,gcsH, - NG1404 NG1405 tpn, - NG1412 gcvT,gcsT, - NG1406 nosR, - NG1401 nosR, - NG1402 hemA,hem1, - NG1403 asnC, - NG1407 NG1408 NG1411 NG1410
* Calculated from Protein Sequence

Gene ID: NG1406

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcvT  gcsT  

Definition:
aminomethyltransferase (glycine cleavage system T protein)

Gene Start:
1372301

Gene Stop:
1371204

Gene Length:
1098

Molecular Weight*:
39625

pI*:
5.90

Net Charge*:
-5.10

EC:
2.1.2.10  

Functional Class:
Central intermediary metabolism; Glycine cleavage system  

Pathway: pathway table
Glycine, serine and threonine metabolism
Nitrogen metabolism
One carbon pool by folate

Secondary Evidence:
Stauffer,L.T., Ghrist,A. and Stauffer,G.V.
The Escherichia coli gcvT gene encoding the T-protein of the
glycine cleavage enzyme system. DNA Seq. 3 (6), 339-346 (1993)
M:94033619


Okamura-Ikeda,K., Ohmura,Y., Fujiwara,K. and Motokawa,Y.
Cloning and nucleotide sequence of the gcv operon encoding the
Escherichia coli glycine-cleavage system
Eur. J. Biochem. 216 (2), 539-548 (1993)
M:93387305

Stauffer LT, Stauffer GV.
Role for the leucine-responsive regulatory protein (Lrp) as a structural protein in regulating the Escherichia
coli gcvTHP operon.
Microbiology. 1999 Mar;145 ( Pt 3):569-76.
PMID: 10217490

Turner SJ, Lewis GD, Bellamy AR.
A genomic polymorphism located downstream of the gcvP gene of Escherichia coli that correlates with ecological
niche.
Mol Ecol. 1997 Nov;6(11):1019-32.
PMID: 9394461




Comment:
Oklahoma ID: NGO.1406c

The glycine cleavage system comprises four proteins: P,T,L and H.
The P protein is NG1325 and the H protein is NG1404. The L component may be NG0562.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to aminomethyltransferases. Residues 7-362 are 55% similar to the T1 protein of P.aeruginosa (gb|AAG08600).

Residues 1-366 are virtually identical to NMB0574 in N.meningitidis (gb|AAF41002).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0404
COG name: Glycine cleavage system T protein (aminomethyltransferase)
Functional Class:  E
The phylogenetic pattern of COG0404 is ---kyqvcebr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002536 (Glycine cleavage T-protein (aminomethyl transferase)) with a combined E-value of 1.6e-78.
    IPB002536A    23-32
    IPB002536B    43-54
    IPB002536C    82-105
    IPB002536D    147-161
    IPB002536E    190-201
    IPB002536F    224-257
    IPB002536G    309-330


ProDom Summary:  Protein Domain Search
Residues 7-47 are 63% similar to a (AMINOMETHYLTRANSFERASE TRANSFERASE) protein domain (PD003737) which is seen in GCST_ECOLI.

Residues 48-359 are 50% similar to a (AMINOMETHYLTRANSFERASE TRANSFERASE) protein domain (PD003070) which is seen in GCST_ECOLI.



Paralogs:  Local Blast Search


NG1406 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 48 to 360 (E-value = 1.3e-137) place NG1406 in the GCV_T family which is described as Glycine cleavage T-protein (aminomethyl transferase) (PF01571)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
36  
104
non-globular  
213  
313

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTALKTTPFHQAHQDAGAKPVDFAGWELPIHYGSQIAEHEAVRTDAGMFD
VSHMLVTDVVGANAKAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDD
LIVYRTNEAETQYRIVSNGATREKDTAQFHKVGQEFGVAFNPRYDLGMLA
VQGPKAIEKLLTVKPEWADVIHGLKPFQGADLGNDWFVARTGYTGEDGVE
VILPDTEAVAFFKALQTAGVQPCGLGARDTLRMEAGMNLYGNDMDDDTSP
LEAGMGRTVDLKDESRDFVGKAALLALKEKGVAVKQVGLLLEKGGILRAH
MEVLTDKGKGETTSGVFSPSLKQSIAIARVPKDFDGDTAKVLIRGKEADV
RVLKLPFVRSGQKQFD

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGCTCTGAAAACCACCCCGTTTCATCAAGCCCATCAAGATGCAGG
CGCGAAGCCGGTAGATTTTGCCGGCTGGGAACTGCCCATCCATTATGGTT
CGCAAATCGCCGAACACGAAGCCGTGCGCACCGACGCCGGTATGTTTGAC
GTATCCCATATGCTCGTTACCGACGTCGTCGGAGCGAACGCCAAAGCCTT
TTTCCGCAAATTGATTGCCAACGACGTTGCCAAACTCGCTTTTGTCGGCA
AAGCCCTTTATTCCGCTTTGCTCAACGACAACGGCGGCGTGATTGACGAC
TTGATCGTTTACCGCACCAACGAGGCCGAAACCCAATACCGCATCGTGTC
CAACGGTGCGACCCGTGAAAAAGACACGGCACAATTCCACAAAGTCGGAC
AAGAGTTCGGCGTTGCCTTCAATCCGCGCTACGACCTCGGTATGCTTGCC
GTACAAGGTCCTAAAGCCATTGAAAAACTCCTGACCGTCAAACCCGAATG
GGCGGATGTGATTCACGGCCTCAAACCGTTCCAAGGCGCGGATTTGGGCA
ACGACTGGTTTGTCGCCCGTACAGGCTACACCGGCGAAGACGGCGTCGAA
GTGATTCTGCCGGATACCGAAGCCGTCGCATTCTTCAAAGCCCTGCAAAC
AGCAGGCGTACAGCCTTGCGGCCTCGGCGCGCGCGACACCCTGCGCATGG
AAGCCGGTATGAACCTCTACGGCAACGATATGGACGACGACACCAGCCCG
CTCGAAGCAGGCATGGGCCGGACGGTTGATTTGAAAGACGAAAGCCGCGA
TTTTGTCGGTAAAGCCGCCTTGTTGGCATTGAAAGAAAAAGGCGTTGCCG
TCAAACAAGTCGGTTTGCTGCTCGAAAAAGGCGGCATCCTGCGCGCGCAT
ATGGAAGTGTTGACCGACAAAGGAAAAGGCGAAACCACCAGCGGCGTATT
CTCGCCCAGCCTGAAACAATCTATCGCCATCGCCCGCGTACCGAAAGATT
TTGACGGCGATACCGCCAAAGTCCTGATTCGCGGCAAAGAAGCGGACGTG
CGCGTACTGAAGCTGCCGTTCGTCCGCAGCGGTCAAAAACAGTTTGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy