Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1144.3 IGR1149 IGR1146 IGR1144.2 IGR1147 IGR1145 IGR1144.4 IGR1150 IGR1144.1 IGR1148 gcvH,gcsH, - NG1404 NG1405 gcvT,gcsT, - NG1406 nosR, - NG1401 nosR, - NG1402 hemA,hem1, - NG1403 nosZ, - NG1400 NG1410 asnC, - NG1407 NG1408 gcvH,gcsH, - NG1404 NG1405 gcvT,gcsT, - NG1406 nosR, - NG1401 nosR, - NG1402 hemA,hem1, - NG1403 nosZ, - NG1400 NG1410 asnC, - NG1407 NG1408 gcvH,gcsH, - NG1404 NG1405 gcvT,gcsT, - NG1406 nosR, - NG1401 nosR, - NG1402 hemA,hem1, - NG1403 nosZ, - NG1400 asnC, - NG1407 NG1408 NG1410
* Calculated from Protein Sequence

Gene ID: NG1403

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemA  hem1  

Definition:
glutamyl-tRNA reductase (HemA)

Gene Start:
1369924

Gene Stop:
1368680

Gene Length:
1245

Molecular Weight*:
45442

pI*:
5.10

Net Charge*:
-10.51

EC:
1.2.1.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  
Central intermediary metabolism; Other  

Pathway: pathway table
Phenylalanine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism

Primary Evidence:
Lewis,L.A., Sung,M.H., Gipson,M., Hartman,K. and Dyer,D.W.
Transport of intact porphyrin by HpuAB, the hemoglobin-haptoglobin
utilization system of Neisseria meningitidis.
J. Bacteriol. 180 (22), 6043-6047 (1998)
M: 99030330


Secondary Evidence:
Elliott,T.
Cloning, genetic characterization, and nucleotide sequence of the
hemA-prfA operon of Salmonella typhimurium.
J. Bacteriol. 171 (7), 3948-3960 (1989)
M: 89291746

Schauer S, Chaturvedi S, Randau L, Moser J, Kitabatake M, Lorenz S, Verkamp E, Schubert WD, Nakayashiki T, Murai M, Wall K,
Thomann HU, Heinz DW, Inokuchi H, Soll D, Jahn D
Escherichia coli glutamyl-tRNA reductase. Trapping the thioester intermediate.
J Biol Chem. 2002 Dec 13;277(50):48657-63.
PMID: 12370189

Moser J, Schubert WD, Heinz DW, Jahn D.
Structure and function of glutamyl-tRNA reductase involved in 5-aminolaevulinic acid formation.
Biochem Soc Trans. 2002 Aug;30(4):579-84.
PMID: 12196141


Comment:
Oklahoma ID: NGO.1403c

For other 'hem' genes, see NG0040 (hemL), NG0234 and NG1580 (hemN), NG0293 (hemH), NG0360 (hemX), NG0362 (hemE), NG0385 (hemB), NG1318 (hemO), NG2015 (hemK).

Blast Summary:  PSI-Blast Search
NG1403 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 3925359, a predicted glutamyl-tRNA reductase (HemA).

Several matches in gapped BLAST to GLUTR sequences. Residues 1-415 are 47% similar to HEM1_PSEAE (gb|AAG08053).

Residues 1-415 are virtually identical to NMB0576 in N.meningitidis (gb|AAF41004).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0373
COG name: Glutamyl-tRNA reductase
Functional Class:  H
The phylogenetic pattern of COG0373 is amt--q-cebr-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000343 (Glutamyl-tRNA reductase) with a combined E-value of 1.5e-109.
    IPB000343A    5-21
    IPB000343B    47-56
    IPB000343C    94-117
    IPB000343D    136-168
    IPB000343E    180-210
    IPB000343F    241-260
    IPB000343G    270-284
    IPB000343H    295-311
    IPB000343I    380-390


ProDom Summary:  Protein Domain Search
Residues 1-34 are 82% similar to a (GLUTAMYL-TRNA REDUCTASE) protein domain (PD188670) which is seen in Q9ZHD6_NEIGO.



Paralogs:  Local Blast Search


NG1403 is paralogously related to NG1602 (shikimate dehydrogenase (AroE)) (3e-04).


Pfam Summary:  Pfam Search
Residues 6 to 152 (E-value = 4.3e-86) place NG1403 in the GlutR_N family which is described as Glutamyl-tRNAGlu reductase, N-terminal domain (PF05201)
Residues 156 to 312 (E-value = 1.6e-82) place NG1403 in the GlutR_NAD_bind family which is described as Glutamyl-tRNAGlu reductase, NAD(P) binding domain (PF05200)
Residues 316 to 414 (E-value = 3.2e-35) place NG1403 in the GlutR_dimer family which is described as Glutamyl-tRNAGlu reductase, dimerisation domain (PF00745)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
24
coil-coil  
342  
377

PDB Hit:
pdb|1GPJ|1GPJ-A GLUTAMYL-TRNA REDUCTASE FROM METHANOPYRUS 181.0 2e-46

Gene Protein Sequence:
MQLTAVGLNHQTAPLSIREKLAFAAAALPEAVRNLARSNAATEAVILSTC
NRTELYCVGDSEEIIRWLADYHSLPIEEIRPYLYTLDMQETVRHAFRVAC
GLDSMVLGEPQILGQIKDAVRAAQEQESMGAKLNALFQKTFSVAKEVRTD
TAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKN
PRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHDYDVVVSSTASQ
LPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDM
VNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIKALRDEGE
KARKQVLENAMKQLAKGATAEEVLERLSVQLTNKLLHSPTQTLNKAGEED
KDLVHAVAQIYHLDK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACTTACCGCTGTCGGACTCAATCATCAAACCGCACCTTTAAGCAT
ACGGGAAAAGCTGGCGTTTGCCGCCGCCGCCCTGCCAGAAGCCGTCCGCA
ATCTTGCCCGAAGCAATGCGGCAACGGAGGCGGTAATCCTTTCTACCTGC
AACCGCACCGAGCTTTACTGCGTCGGCGATTCGGAAGAAATCATCCGATG
GCTTGCCGATTACCACAGTTTGCCGATTGAAGAAATCCGTCCGTATCTGT
ACACGCTGGATATGCAGGAAACCGTGCGCCACGCCTTCCGCGTTGCCTGC
GGCTTGGATTCGATGGTTTTGGGCGAGCCGCAGATTTTGGGGCAGATTAA
AGATGCGGTGCGTGCGGCTCAAGAACAGGAAAGTATGGGGGCAAAACTCA
ATGCCCTGTTCCAAAAAACCTTTTCCGTTGCTAAAGAAGTCCGTACCGAT
ACCGCTGTCGGCGAAAATTCGGTTTCGATGGCTTCCGCGTCCGTCAAGTT
GGCGGAACAGATTTTTCCCGACATCGGCGATTTGAACGTATTGTTTATCG
GCGCAGGCGAAATGATTGAGCTGGTTGCCACTTATTTTGCCGCCAAAAAT
CCCCGGCTGATGACGGTTGCCAACCGGACGCTGGCGCGTGCACAGGAGTT
GTGCGACAAGCTCGGTGTTAACGCCGAACCGTGCCTGCTGTCCGATCTGC
CTGCCATTCTGCACGATTACGACGTGGTGGTTTCTTCAACGGCGAGCCAG
CTTCCGATAGTCGGCAAAGGCATGGTCGAACGCGCATTGAAACAGCGTCA
GAGTATGCCGTTGTTCATGCTTGACTTGGCCGTGCCGCGCGATATTGAAG
CGGAAGTCGGCGATTTGAACGATGCGTATCTTTATACGGTGGACGATATG
GTCAACATCGTCCAAAGCGGCAAGGAGGCAAGGCAGAAGGCCGCCGCCGC
CGCCGAAACGCTGGTGTCCGAAAAGGTTGCCGAATTTGTCAGGCAGCAGC
AGGGCAGGCAGAGCGTTCCGCTGATTAAGGCCTTGCGGGACGAGGGCGAG
AAAGCGCGCAAGCAGGTGTTGGAAAATGCGATGAAACAGCTTGCCAAAGG
CGCAACGGCGGAAGAGGTTTTGGAACGGCTGTCCGTCCAACTGACCAACA
AGCTGCTGCATTCGCCAACTCAAACCTTGAATAAGGCGGGGGAAGAAGAT
AAAGATTTGGTTCATGCCGTCGCGCAGATTTATCATTTGGACAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy