Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1140 IGR1144 IGR1142 IGR1143 IGR1141 IGR1144.1 nosL, - NG1397 nosD, - NG1399.1 tpn, - NG1394 nosD, - NG1399.2 nosY, - NG1398 nosF, - NG1399 mafA2, - NG1393 mafB2, - NG1392 etfD, - NG1396 nosL, - NG1397 nosD, - NG1399.1 tpn, - NG1394 nosD, - NG1399.2 nosY, - NG1398 nosF, - NG1399 mafA2, - NG1393 mafB2, - NG1392 etfD, - NG1396 Type: inverse, Name:  - 138 Type: tandem, Name:  - 61 nosL, - NG1397 nosD, - NG1399.1 tpn, - NG1394 nosD, - NG1399.2 nosY, - NG1398 nosF, - NG1399 mafA2, - NG1393 mafB2, - NG1392 etfD, - NG1396 NG1395 NG1395
* Calculated from Protein Sequence

Gene ID: NG1396

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
etfD  

Definition:
electron transfer flavoprotein-ubiquinone oxidoreductase

Gene Start:
1358286

Gene Stop:
1360091

Gene Length:
1806

Molecular Weight*:
66762

pI*:
6.40

Net Charge*:
-5.10

EC:
1.5.5.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table

Secondary Evidence:
Goodman,S.I., Axtell,K.M., Bindoff,L.A., Beard,S.E., Gill,R.E. and
Frerman,F.E.
Molecular cloning and expression of a cDNA encoding human electron
transfer flavoprotein-ubiquinone oxidoreductase. Eur. J. Biochem. 219 (1-2), 277-286 (1994)
Medline: 94139702


Comment:
For other 'etf' genes see NG1936 (etfA) and NG1935 (etfB).

Oklahoma ID: NGO.1396

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to ubiquinone oxidoreductases and related enzymes, many of which are eukaryotic. Residues 50-602 are 55% similar to the predicted enzyme in Zymomonas mobilis (gb|AAD21543).

Residues 1-602 are virtually identical to NMA0766 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0644
COG name: Dehydrogenases (flavoproteins)
Functional Class:  C
The phylogenetic pattern of COG0644 is AMTKyQvCE-R----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000103 (Pyridine nucleotide-disulphide oxidoreductase class-II) with a combined E-value of 2.8e-08.
    IPB000103A    62-82
    IPB000103E    369-406
***** PR00420 (Aromatic-ring hydroxylase (flavoprotein monooxygenase) signature) with a combined E-value of 8.3e-06.
    PR00420A    62-84


ProDom Summary:  Protein Domain Search
Residues 63-111 are 61% similar to a (OXIDOREDUCTASE FLAVOPROTEIN FAD REDUCTASE REDOX-ACTIVE) protein domain (PD000139) which is seen in ETFD_HUMAN.

Residues 125-277 are 56% similar to a (ELECTRON TRANSFER OXIDOREDUCTASE) protein domain (PD011193) which is seen in ETFD_ACICA.

Residues 278-446 are 58% similar to a (OXIDOREDUCTASE FLAVOPROTEIN FAD ELECTRON TRANSFER) protein domain (PD013436) which is seen in ETFD_HUMAN.

Residues 53-124 are 67% similar to a (PROBABLE ELECTRON TRANSFER) protein domain (PD022634) which is seen in ETFD_ACICA.

Residues 450-602 are 58% similar to a (ELECTRON TRANSFER OXIDOREDUCTASE) protein domain (PD011189) which is seen in ETFD_HUMAN.

Residues 61-124 are 68% similar to a (OXIDOREDUCTASE FAD FLAVOPROTEIN PROTEIN OXIDASE) protein domain (PD000271) which is seen in ETFD_CAEEL.



Paralogs:  Local Blast Search


NG1396 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 450 to 602 (E-value = 1.2e-119) place NG1396 in the ETF_QO family which is described as Electron transfer flavoprotein-ubiquinone oxidoreductase (PF05187)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MVACLLKFRQRSSENRKHGFRRPLLYLVTICSRCIITDLQFNNKYTGTAM
TESITRDSMQYDVVIVGAGPSGLSAAIKLKQLAEQNGREISVCVVEKGSE
AGAHSLAGAVIDPIALNELIPDWKEKGAPLTRTVTQDKVLFLTEKKAFNL
PITPNFDNHGNYIVSLGEVVRWLAEQAENMGVEIYPGFAAAEVLYHEDGS
VKGIATGNMGVGKDGGPTDSFQPGMELWARQTLFAEGCRGSLSKQIIERF
QLDQNSQPQTYGLGIKEVWEVPSEQHQPGLVVHSAGWPLDSKTYGGAFIY
HFDDNKVAVGFVVGLDYQNPYLSPFEEFQRFKTHPEIRKTFEGGRRIAYG
ARSLIEGGLQSLPKLSFKGGVLIGDAAGFLNMPRIKGIHTSMKSAMLAAE
AVFPLLENFEEVESFDSGKEAGNYQKLFEQSWLYQELYAARNVRPSFKWG
VYLGSLYTGIDQMIFRGKAPWTLKHHGKDNEQLKKAAVCKPIDYPKPDGV
LTFDRLSSVFLANLAHEENQPDHLVLNNPQTMIDVNYKEYASPETRYCPA
GVYEIIEENGSPRLQINAANCVHCKTCDIKDPTQNITWICPEGASGPNYG
GM

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTGGCGTGCTTATTGAAATTTCGACAAAGGTCGTCTGAAAACCGAAA
ACATGGTTTCAGACGACCTTTGTTGTATTTGGTAACTATATGTTCCCGTT
GTATAATTACGGATTTGCAATTCAATAATAAATACACAGGAACCGCCATG
ACAGAATCCATCACCCGCGACAGTATGCAATACGATGTCGTGATTGTCGG
CGCAGGCCCGTCGGGGTTGTCCGCCGCCATCAAACTCAAGCAGCTTGCCG
AACAGAACGGGCGCGAAATCAGCGTTTGCGTGGTGGAGAAGGGTTCGGAG
GCGGGGGCGCATTCGCTGGCGGGCGCGGTTATCGATCCGATTGCGCTGAA
TGAGCTGATTCCCGACTGGAAAGAAAAAGGCGCGCCGCTGACGCGCACGG
TAACTCAGGACAAGGTGTTGTTCCTGACGGAGAAAAAAGCGTTCAATCTG
CCTATTACCCCGAATTTCGACAATCACGGCAACTACATCGTCAGCTTAGG
CGAAGTCGTGCGCTGGTTGGCGGAGCAGGCGGAAAATATGGGCGTGGAAA
TCTATCCGGGCTTTGCCGCCGCCGAAGTGCTGTATCACGAAGACGGCTCG
GTCAAAGGTATTGCGACCGGCAATATGGGTGTAGGCAAAGACGGCGGGCC
GACCGACAGTTTCCAGCCCGGCATGGAGCTTTGGGCGCGGCAAACCCTGT
TTGCCGAAGGTTGCCGAGGTTCGCTTTCCAAGCAAATCATCGAACGTTTC
CAACTCGACCAAAACAGCCAGCCGCAAACTTACGGCTTGGGCATCAAAGA
AGTTTGGGAAGTGCCGTCTGAACAGCATCAGCCCGGTTTGGTGGTGCATA
GCGCAGGCTGGCCGCTGGACAGCAAAACCTACGGCGGTGCGTTTATTTAC
CATTTCGACGACAACAAAGTCGCCGTCGGCTTCGTGGTCGGTTTGGACTA
TCAAAACCCGTATCTGTCGCCGTTTGAAGAGTTCCAACGTTTCAAAACCC
ATCCCGAAATCCGCAAAACCTTTGAAGGCGGCCGCCGCATTGCTTACGGC
GCGCGTTCGCTGATTGAAGGCGGTTTGCAAAGCCTGCCGAAGCTCTCGTT
CAAGGGGGGCGTTTTAATCGGCGATGCGGCGGGGTTCCTCAATATGCCGC
GCATCAAAGGCATTCATACCTCGATGAAATCCGCCATGCTCGCCGCCGAA
GCCGTGTTCCCCTTGTTGGAAAACTTTGAAGAAGTGGAAAGCTTCGACAG
CGGCAAAGAAGCGGGAAACTATCAAAAACTGTTTGAACAAAGCTGGCTGT
ATCAAGAGCTTTATGCCGCGCGCAATGTCCGTCCGTCATTCAAATGGGGC
GTTTACCTCGGCTCGCTTTATACCGGCATCGACCAGATGATTTTCAGAGG
CAAAGCCCCGTGGACCTTGAAACATCACGGCAAAGACAACGAGCAGCTCA
AAAAAGCCGCCGTGTGCAAGCCGATTGATTATCCGAAACCCGACGGTGTG
TTGACCTTTGACCGCTTGAGCAGCGTCTTCCTTGCCAATCTCGCGCACGA
AGAAAACCAGCCCGACCATTTGGTGCTGAACAATCCGCAAACGATGATAG
ACGTGAACTATAAAGAATACGCCTCTCCCGAAACGCGCTATTGTCCGGCC
GGCGTATATGAAATCATCGAAGAAAACGGCAGTCCGCGCCTGCAAATCAA
CGCGGCAAACTGCGTGCACTGCAAAACCTGCGACATCAAAGACCCGACGC
AAAACATCACTTGGATTTGCCCCGAAGGCGCAAGCGGACCGAATTACGGC
GGGATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy