Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1128 IGR1129 IGR1133 IGR1134 IGR1131 IGR1137 IGR1136 IGR1132 IGR1135 IGR1130 IGR1135.1 IGR1127 NG1385.1 NG1383 exbD, - NG1377 NG1387 NG1385 grx2,glr2, - NG1381 NG1386 exbB, - NG1378 tonB, - NG1379 NG1380 relA, - NG1382 NG1385.1 NG1383 exbD, - NG1377 NG1387 NG1385 grx2,glr2, - NG1381 NG1386 exbB, - NG1378 tonB, - NG1379 NG1380 relA, - NG1382 exbD, - NG1377 NG1387 grx2,glr2, - NG1381 NG1386 exbB, - NG1378 tonB, - NG1379 NG1384 NG1383 NG1385 NG1384 NG1385.1 NG1380 relA, - NG1382
* Calculated from Protein Sequence

Gene ID: NG1382

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
relA  

Definition:
GTP pyrophosphokinase

Gene Start:
1346190

Gene Stop:
1348400

Gene Length:
2211

Molecular Weight*:
82390

pI*:
6.60

Net Charge*:
-4.20

EC:
2.7.6.5  

Functional Class:
Other categories; Adaptations and atypical conditions  
Regulatory functions  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Metzger,S., Dror,I.B., Aizenman,E., Schreiber,G., Toone,M.,
Friesen,J.D., Cashel,M. and Glaser,G.
The nucleotide sequence and characterization of the relA gene of
Escherichia coli.
J. Biol. Chem. 263 (30), 15699-15704 (1988)
M: 89008481


Comment:
Oklahoma ID: NGO.1382

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to GTP pyrophosphokinases. Residues 78-737 are 43% similar to the enzyme in V.cholerae (gb|AAF95593).

Residues 1-737 are virtually identical to NMA1991 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0317
COG name: Guanosine polyphosphate pyrophosphohydrolases/synthetases
Functional Class:  T,K
The phylogenetic pattern of COG0317 is -----qvcEbrHujgpo----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 545-650 are 38% similar to a (SYNTHETASE GTP PYROPHOSPHOKINASE PPGPP) protein domain (PD003989) which is seen in RELA_VIBSS.

Residues 226-388 are 53% similar to a (HYDROLASE SYNTHETASE PROTEIN PPGPP) protein domain (PD002902) which is seen in O32419_STAAU.

Residues 57-195 are 41% similar to a (HYDROLASE PROTEIN SYNTHETASE GTP PYROPHOSPHOKINASE PPGPP) protein domain (PD002764) which is seen in SPOT_HAEIN.

Residues 409-555 are 41% similar to a (HYDROLASE SYNTHETASE GTP) protein domain (PD002918) which is seen in P74007_SYNY3.



Paralogs:  Local Blast Search


NG1382 is paralogously related to NG1308 (guanosine-3',5'-bis(diphosphate)3'-pyrophosphohydrolase) (1e-104).


Pfam Summary:  Pfam Search
Residues 260 to 372 (E-value = 8.7e-76) place NG1382 in the RelA_SpoT family which is described as Region found in RelA / SpoT proteins (PF04607)
Residues 410 to 473 (E-value = 2.3e-30) place NG1382 in the TGS family which is described as TGS domain (PF02824)
Residues 665 to 737 (E-value = 2.8e-11) place NG1382 in the ACT family which is described as ACT domain (PF01842)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
43  
88
coil-coil  
108  
150
transmembrane  
146  
162
coil-coil  
223  
255
coil-coil  
678  
705

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTAISPIQDTQSATLQELREWFDSYCAALPDNDKNLIGTAWSLAQEHYPA
DAATPYGEPLPDHFLGAAQMVDELDLLPDAVAATLLADIGRYVPDWNLLV
SERCNSTVAELVKGVDEVQKLTHFARVDSLATPEERAQQAETMRKMLLAM
VTDIRVVLIKLAMRTRTLQFLSNAPDSPEKRAVAKETLDIFAPLANRLGV
WQLKWQLEDLGFRHQEPEKYREIALLLDEKRTERLEYIENFLDILRTELK
KYNIHFEVAGRPKHIYSIYKKMVKKKLSFDGLFDIRAVRILVDTVPECYT
TLGIVHSLWQPIPGEFDDYIANPKGNGYKSLHTVIVGPEDKGVEVQIRTF
DMHQFNEFGVAAHWRYKEGGKGDSAYEQKIAWLRQLLDWRENMAESGKED
LAAAFKTELFNDTIYVLTPHGKVLSLPTGATPIDFAYALHSSIGDRCRGA
KVEGQIVPLSTPLENGQRVEIITAKEGHPSVNWLYEGWVKSGKAIGKIRA
YIRQQNADTVREEGRVQLDKQLAKLTPKPNLQELAENLGYKKPEDLYTAV
GQGEISNRAIQKACGTLNEPPPVPVSATTIVKQSKIKKGGKTGVLIDGED
GLMTTLAKCCKPAPPDDIAGFVTRERGISVHRKTCPSFRHLAEHAPEKVL
DASWAALQEGQVFAVDIEIRAQDRSGLLRDVSDALARHKLNVTAVQTQSR
DLEASMRFTLEVKQVNDLPRVLAGLGDVKGVLSVTRL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGCCATCAGCCCGATTCAAGACACGCAAAGCGCGACCCTGCAAGA
ATTGCGCGAATGGTTCGACAGCTACTGCGCCGCTCTGCCGGACAACGATA
AAAACCTCATCGGTACCGCATGGTCGCTGGCGCAGGAACATTATCCTGCC
GATGCCGCCACGCCGTATGGCGAGCCGCTGCCCGACCACTTCCTCGGCGC
GGCGCAAATGGTCGACGAACTCGACCTGCTGCCCGATGCCGTCGCCGCCA
CCCTGCTTGCCGACATCGGACGCTACGTCCCCGATTGGAACCTATTGGTT
TCCGAGCGCTGCAACAGCACCGTCGCCGAGCTGGTCAAAGGTGTGGACGA
AGTGCAGAAACTTACCCACTTCGCCCGGGTGGACAGCCTCGCCACGCCGG
AAGAACGCGCACAGCAAGCGGAAACCATGCGGAAAATGCTGCTGGCGATG
GTTACCGACATCCGCGTCGTATTAATCAAACTGGCGATGCGTACGCGCAC
CCTGCAATTTTTAAGCAACGCCCCCGACAGCCCTGAAAAACGCGCCGTCG
CCAAAGAAACCCTCGACATCTTCGCCCCGCTCGCCAACCGCTTGGGCGTG
TGGCAGCTCAAATGGCAGCTCGAAGATTTGGGCTTCCGCCATCAAGAACC
CGAAAAATACCGCGAAATCGCCCTGCTTTTGGACGAAAAACGCACCGAAC
GCCTCGAATACATCGAAAACTTCCTCGATATCCTGCGTACGGAACTCAAA
AAATACAATATCCACTTTGAAGTCGCCGGCCGTCCGAAACACATCTACTC
CATTTACAAAAAAATGGTGAAGAAAAAACTCAGCTTCGACGGCCTGTTCG
ACATCCGCGCCGTGCGGATTCTGGTCGATACCGTCCCCGAGTGTTACACC
ACGCTGGGCATCGTCCACAGCCTCTGGCAGCCCATTCCCGGCGAGTTCGA
CGACTACATCGCCAACCCCAAAGGCAACGGTTATAAAAGTTTGCACACCG
TCATCGTCGGCCCGGAAGACAAAGGTGTGGAAGTGCAAATCCGCACCTTC
GATATGCACCAATTCAACGAATTCGGTGTCGCCGCCCACTGGCGTTACAA
AGAAGGCGGCAAAGGCGATTCCGCCTACGAACAAAAAATCGCCTGGTTGC
GCCAACTCTTGGACTGGCGCGAAAATATGGCGGAAAGCGGCAAGGAAGAC
CTCGCCGCCGCCTTCAAAACCGAGCTTTTCAACGACACGATTTATGTTTT
GACCCCGCACGGCAAAGTCCTCTCTCTGCCAACGGGCGCAACCCCCATCG
ACTTCGCCTACGCCCTGCACAGCAGCATCGGCGACCGCTGCCGGGGCGCG
AAAGTCGAAGGGCAGATTGTGCCGCTGTCCACCCCGCTCGAAAACGGACA
GCGCGTCGAAATCATTACCGCCAAAGAAGGGCATCCTTCCGTCAACTGGC
TTTACGAAGGCTGGGTCAAATCCGGCAAGGCCATCGGCAAAATCCGCGCC
TACATCCGCCAGCAAAACGCCGACACCGTGCGCGAAGAAGGCCGTGTCCA
ACTCGACAAGCAGCTTGCCAAACTCACGCCCAAACCCAACCTGCAAGAGC
TTGCCGAAAATCTCGGCTACAAAAAGCCAGAAGACCTCTACACCGCCGTC
GGACAAGGCGAAATTTCCAACCGCGCCATCCAAAAAGCCTGCGGCACGCT
GAACGAACCGCCGCCCGTGCCCGTCAGCGCAACCACCATCGTCAAACAGT
CCAAAATCAAAAAAGGTGGCAAAACCGGCGTGCTCATCGACGGCGAAGAC
GGCTTGATGACCACGCTTGCCAAATGCTGCAAACCCGCGCCGCCCGACGA
TATTGCCGGCTTCGTTACCCGCGAGCGCGGCATTTCCGTCCACCGCAAAA
CCTGCCCCTCTTTCCGACACCTTGCCGAACACGCGCCCGAAAAAGTACTG
GACGCAAGTTGGGCGGCGTTGCAGGAAGGGCAAGTGTTCGCCGTCGATAT
CGAAATCCGCGCCCAAGACCGCTCCGGGCTTTTGCGCGACGTATCCGACG
CGCTCGCCCGCCACAAACTCAACGTTACCGCCGTGCAAACCCAGTCCCGC
GACTTGGAAGCCAGCATGAGGTTCACGCTCGAAGTCAAACAAGTCAACGA
CCTCCCGCGCGTCCTCGCCGGCCTCGGCGATGTCAAAGGCGTATTGAGCG
TTACCCGGCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy