Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1128 IGR1123 IGR1129 IGR1122 IGR1126 IGR1124 IGR1120 IGR1125 IGR1121 IGR1127 ccoQ, - NG1372 exbD, - NG1377 ccoO, - NG1373 exbB, - NG1378 tonB, - NG1379 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 NG1376 NG1375 ccoQ, - NG1372 exbD, - NG1377 ccoO, - NG1373 exbB, - NG1378 tonB, - NG1379 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 NG1376 NG1375 exbD, - NG1377 ccoO, - NG1373 tonB, - NG1379 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 ccoQ, - NG1372 exbB, - NG1378 NG1376 NG1375
* Calculated from Protein Sequence

Gene ID: NG1374

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ccoN  

Definition:
cytochrome c oxidase subunit I (CcoN)

Gene Start:
1339368

Gene Stop:
1337926

Gene Length:
1443

Molecular Weight*:
53938

pI*:
9.80

Net Charge*:
10.69

EC:
1.9.3.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Electron Transport System, Complex IV
Oxidative phosphorylation

Secondary Evidence:
Kahn,D., David,M., Domergue,O., Daveran,M.L., Ghai,J., Hirsch,P.R.and Batut,J. Rhizobium meliloti fixGHI sequence predicts involvement of a specific cation pump in symbiotic nitrogen fixation. J. Bacteriol. 171 (2): 929-939 (1989) [Medline: 89123173].

Comment:
From GenBANK (gi:120197): In Sinorhizobium meliloti, four proteins FixG, FixH, FixI, and FixS may participate in a membrane-bound complex coupling the FixI cation pump with a redox process catalyzed by fixG.

See also: FixS, NG0975, and FixG, NG1026.

Oklahoma ID: NGO.1374c

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to cytochrome c oxidase subunit I (cbb3 type) sequences. Residues 1-474 are 71% similar to the subunit sequence from P.aeruginosa (gb|AAG04946).

Residues 1-481 are virtually identical to NMB1725 in N.meningitidis (gb|AAF42070).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0843
COG name: Cytochrome c oxidase, heme b and copper-binding subunit
Functional Class:  C
The phylogenetic pattern of COG0843 is -----Q-CeBr-uj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 159-319 are 73% similar to a (HEME OXIDOREDUCTASE COPPER TRANSMEMBRANE) protein domain (PD005435) which is seen in P72288_RHILE.

Residues 320-472 are 59% similar to a (HEME OXIDOREDUCTASE COPPER TRANSMEMBRANE) protein domain (PD003684) which is seen in Q9Z9I1_MAGMG.

Residues 20-156 are 62% similar to a (HEME OXIDOREDUCTASE COPPER TRANSMEMBRANE) protein domain (PD003369) which is seen in O06656_RHILE.



Paralogs:  Local Blast Search


NG1374 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 435 (E-value = 1e-71) place NG1374 in the COX1 family which is described as Cytochrome C and Quinol oxidase polypeptide I (PF00115)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
36
transmembrane  
100  
116
transmembrane  
133  
149
transmembrane  
169  
185
transmembrane  
213  
229
transmembrane  
275  
291
transmembrane  
388  
404

PDB Hit:
pdb|1AR1|1AR1-A STRUCTURE AT 2.7 ANGSTROM RESOLUTION OF THE 58.6 3e-09
pdb|1QLE|1QLE-A CRYO-STRUCTURE OF THE PARACOCCUS DENITRIFICANS 58.6 3e-09
pdb|1EHK|1EHK-A CRYSTAL STRUCTURE OF THE ABERRANT 55.4 2e-08
pdb|1QLE|1QLE-A CRYO

Gene Protein Sequence:
METLMDTQTYNYKVVRQFAIMTVVWGIVGMLVGVIVAAQLFAPALDLSNI
GPWFHFGRLRPLHTNAVIFAFGGCGLIGTSYYVVQRTCNTRLFGGWLPAF
TFWGWQAVIVAAVVSFPMGWTQGKEYAELEWPIDILITLVWVAYAIVFFG
TIAKRKVKHIYVANWFYGGFILAVALLHIVNNISIPAGLMKSYPVYSGAI
DAMVQWWYGHNAVGFFLTAGFLGMMYYFVPKQAARPVYSYRLSVVHFWAL
IFTYMWAGPHHLHYTALPDWTQSLGMVLSLILFAPSWGGMINGIMTLSGA
WDKLRTDPILKFLIVSLSFYGMSTFEGPMMSIKTVNALSHYTDWTVAHVH
AGALGWVGFVTIGSVYYMIPRLFGKEQMHSTKLVEAHFWIATIGVVLYIA
AMWIAGVMQGLMWSSLNDDGTLTYSFVESVKRTMPYYMIRFAGGLLYLSG
MCIMAYNVYRTAIGGKAVDAEIPAVSQTQHH

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGACTCTCATGGACACACAAACTTACAACTACAAAGTGGTGCGCCA
GTTCGCCATCATGACTGTAGTTTGGGGGATTGTGGGCATGTTGGTCGGCG
TTATCGTCGCCGCCCAGCTTTTTGCTCCTGCCCTCGACTTGTCTAATATC
GGACCTTGGTTCCACTTCGGCCGCCTGCGTCCGCTGCACACCAATGCGGT
TATTTTCGCATTTGGCGGTTGCGGTCTGATCGGCACATCATACTACGTTG
TCCAACGTACTTGTAATACCCGTCTTTTCGGCGGTTGGCTGCCGGCATTT
ACCTTTTGGGGTTGGCAGGCGGTAATCGTTGCCGCCGTCGTCAGCTTCCC
TATGGGTTGGACCCAAGGTAAGGAATATGCCGAACTGGAATGGCCGATTG
ACATTCTGATTACTTTGGTTTGGGTGGCTTACGCCATCGTATTCTTCGGT
ACGATTGCCAAACGCAAGGTAAAACACATTTACGTTGCCAACTGGTTCTA
CGGCGGCTTTATTTTGGCGGTCGCACTTTTGCACATCGTCAACAATATCA
GCATCCCGGCCGGTTTGATGAAGTCATACCCCGTCTATTCCGGTGCGATT
GATGCTATGGTTCAATGGTGGTACGGGCATAACGCCGTGGGCTTCTTCCT
GACTGCCGGCTTTTTGGGTATGATGTACTATTTCGTACCCAAACAAGCAG
CCCGCCCCGTTTACTCCTACCGCCTGTCCGTCGTTCACTTCTGGGCGTTG
ATTTTCACCTATATGTGGGCGGGTCCGCACCATCTTCACTACACTGCGCT
GCCTGACTGGACGCAATCTTTGGGTATGGTTCTGTCCTTGATTTTGTTCG
CACCCTCTTGGGGCGGTATGATTAACGGCATTATGACCTTGTCCGGCGCG
TGGGACAAACTGCGTACAGACCCGATTCTTAAATTCCTGATTGTATCCTT
GTCCTTCTACGGTATGTCTACCTTTGAAGGCCCGATGATGTCGATTAAAA
CGGTCAATGCATTGAGCCACTATACGGACTGGACCGTCGCGCACGTTCAT
GCGGGTGCGTTGGGCTGGGTAGGCTTTGTAACCATCGGTTCCGTCTATTA
CATGATTCCCCGTCTGTTCGGCAAAGAGCAGATGCACAGCACCAAGCTGG
TAGAGGCGCATTTCTGGATTGCGACTATCGGTGTGGTTCTGTATATCGCC
GCGATGTGGATTGCAGGTGTGATGCAGGGTTTGATGTGGAGTTCTCTGAA
CGATGACGGTACGCTGACCTACTCGTTTGTCGAATCCGTAAAACGCACCA
TGCCTTACTACATGATCCGTTTTGCAGGTGGTTTATTGTATCTGAGTGGC
ATGTGCATTATGGCGTACAACGTGTACCGCACAGCCATCGGTGGTAAAGC
AGTCGATGCCGAAATCCCTGCGGTTTCCCAAACACAGCACCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy