Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1123 IGR1122 IGR1126 IGR1124 IGR1120 IGR1125 IGR1121 IGR1127 ccoQ, - NG1372 exbD, - NG1377 ccoO, - NG1373 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 NG1376 NG1375 ccoQ, - NG1372 exbD, - NG1377 ccoO, - NG1373 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 NG1376 NG1375 exbD, - NG1377 ccoO, - NG1373 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 ccoQ, - NG1372 NG1376 NG1375
* Calculated from Protein Sequence

Gene ID: NG1373

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ccoO  

Definition:
cytochrome c oxidase subunit II (CcoO)

Gene Start:
1337896

Gene Stop:
1337288

Gene Length:
609

Molecular Weight*:
22514

pI*:
8.60

Net Charge*:
3.11

EC:
1.9.3.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Electron Transport System, Complex IV
Oxidative phosphorylation

Secondary Evidence:
Toledo-Cuevas,M., Barquera,B., Gennis,R.B., Wikstrom,M. and
Garcia-Horsman,J.A.
The cbb3-type cytochrome c oxidase from Rhodobacter sphaeroides, a
proton-pumping heme-copper oxidase. Biochim. Biophys. Acta 1365 (3), 421-434 (1998)
M:98377154


Comment:
Oklahoma ID: NGO.1373c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to cytochrome c oxidase, chain II sequences. Residues 1-203 are 63% similar to the subunit sequence in P.aeruginosa (gb|AAG04942).

Residues 1-203 are virtually identical to NMB1724 in N.meningitidis (gb|AAF42069).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 13-196 are 49% similar to a (CYTOCHROME C OXIDASE SUBUNIT) protein domain (PD006922) which is seen in Q03074_BRAJA.



Paralogs:  Local Blast Search


NG1373 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 203 (E-value = 4.9e-92) place NG1373 in the FixO family which is described as Cytochrome C oxidase, mono-heme subunit/FixO (PF02433)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
46
cleavable N-terminal sequence  
1  
36

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKLQQLAEEKIGVLIVFTLLVVSVGLLIEVVPLAFTKAATQPAPGVKPYN
ALQVAGRDIYIREGCYNCHSQMIRPFRAETERYGHYSVAGESVYDHPFQW
GSKRTGPDLARVGGRYSDEWHRIHLLNPRDVVPESNMPAFPWLARNKVDV
DATVANMKALRKVGTPYSDEEIAKAPEALANKSELDAVVAYLQGLGLALK
NVR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTACAACAATTGGCTGAAGAAAAAATCGGCGTTCTGATTGTGTT
CACGCTGCTTGTAGTCAGTGTCGGTCTGTTGATTGAAGTTGTGCCCTTGG
CCTTTACCAAGGCGGCAACACAGCCGGCGCCGGGCGTGAAGCCTTACAAT
GCCCTGCAGGTTGCCGGACGCGATATTTACATCCGTGAGGGCTGTTACAA
CTGCCACTCTCAAATGATTCGTCCGTTCCGTGCGGAAACCGAGCGTTACG
GTCATTACTCTGTTGCCGGAGAGTCGGTTTACGACCATCCGTTCCAATGG
GGTTCCAAACGTACCGGTCCTGATTTGGCACGTGTGGGCGGCCGCTATTC
CGACGAATGGCACCGCATCCACCTGCTGAATCCCCGTGATGTCGTGCCTG
AGTCCAATATGCCGGCATTCCCGTGGCTTGCACGCAATAAAGTCGATGTC
GATGCAACCGTTGCCAACATGAAGGCTTTGCGTAAAGTAGGTACTCCTTA
CAGTGATGAGGAAATTGCGAAAGCGCCTGAGGCTTTGGCAAACAAATCCG
AGCTGGATGCTGTAGTCGCCTATCTGCAAGGATTGGGTCTGGCTTTGAAA
AACGTAAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy