Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1123 IGR1122 IGR1126 IGR1124 IGR1120 IGR1125 IGR1121 ccoQ, - NG1372 ccoO, - NG1373 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 NG1375 ccoQ, - NG1372 ccoO, - NG1373 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 NG1375 ccoO, - NG1373 ccoP, - NG1371 NG1370 ccoN, - NG1374 recC, - NG1369 ccoQ, - NG1372 NG1375
* Calculated from Protein Sequence

Gene ID: NG1371

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ccoP  

Definition:
cytochrome c oxidase subunit (CcoP)

Gene Start:
1337086

Gene Stop:
1335770

Gene Length:
1317

Molecular Weight*:
47935

pI*:
6.90

Net Charge*:
-0.42

EC:
1.9.3.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Electron Transport System, Complex IV
Oxidative phosphorylation

Secondary Evidence:
Toledo-Cuevas,M., Barquera,B., Gennis,R.B., Wikstrom,M. and
Garcia-Horsman,J.A.
The cbb3-type cytochrome c oxidase from Rhodobacter sphaeroides, a
proton-pumping heme-copper oxidase. Biochim. Biophys. Acta 1365 (3), 421-434 (1998)
M:98377154

Comment:
Oklahoma ID: NGO.1371c

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to cytochrome c oxidase III sequences. Residues 9-309 are 44% similar to cytochrome c PA1555 in Pseudomonas aeruginosa (gb|AAG04944).

Residues 1-309 are virtually identical to NMB1723 in N.meningitidis (gb|AAF42068).

COGS Summary:  COGS Search
BeTs to 3 clades of COG2010
COG name: Cytochrome c, mono- and diheme variants
Functional Class:  C
The phylogenetic pattern of COG2010 is ---------Br-uj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** PR00607 (Class IE cytochrome C signature) with a combined E-value of 1.5e-16.
    PR00607A    367-378
    PR00607B    378-388
    PR00607C    406-418
    PR00607D    421-432
***** PR00605 (Class IC cytochrome C signature) with a combined E-value of 3.5e-09.
    PR00605A    145-156
    PR00605B    187-209
    PR00605A    366-377
    PR00605B    279-301
***** IPB000345 (Cytochrome c family heme-binding site) with a combined E-value of 8.9e-06.
    IPB000345    360-372
    IPB000345    139-151


ProDom Summary:  Protein Domain Search
Residues 237-305 are 41% similar to a (CYTOCHROME CCOP DI-HEME CP) protein domain (PD015615) which is seen in Q05577_RHIME.

Residues 41-282 are 27% similar to a (CYTOCHROME OXIDASE C SUBUNIT DIHEME MEMBRANE-BOUND FIXP) protein domain (PD126910) which is seen in O87196_HELPY.

Residues 361-431 are 42% similar to a (CYTOCHROME ELECTRON TRANSPORT HEME PHOTOSYNTHESIS C6) protein domain (PD001331) which is seen in C555_CHLLT.

Residues 45-141 are 39% similar to a (CYTOCHROME C CCOP OXIDASE) protein domain (PD007299) which is seen in Q51682_PARDE.



Paralogs:  Local Blast Search


NG1371 is paralogously related to NG1328 (cytochrome C5) (4e-41).


Pfam Summary:  Pfam Search
Residues 137 to 213 (E-value = 1.4e-05) place NG1371 in the Cytochrom_C family which is described as Cytochrome c (PF00034)
Residues 358 to 435 (E-value = 2.3e-05) place NG1371 in the Cytochrom_C family which is described as Cytochrome c (PF00034)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
28
cleavable N-terminal sequence  
1  
28
transmembrane  
68  
84
non-globular  
310  
358

PDB Hit:
pdb|1KX2|1KX2-A MINIMIZED AVERAGE STRUCTURE OF A MONO-HEME 62.1 2e-10
pdb|1CC5|1CC5 CYTOCHROME C=5= (OXIDIZED) 59.7 1e-09
pdb|1GKS|1GKS ECTOTHIORHODOSPIRA HALOPHILA CYTOCHROME C551 49.2 1e-06
pdb|1GDV|1GDV-A CRYS

Gene Protein Sequence:
MNATSQFTSNFWNIYIAVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTG
HEWDGIAEYDNPLPRWWFWLCVLTWLFGIGYLVMYPGVGDYKGLLKWTSH
NQYEKEVKKADEQYGKLYAKFADMPIEKVAKDPQAKQIAQNLFNTYCIQC
HGSDAKGSKGFPNLTDSDWLWGGDPDKIHETIEKGRVATMPAWGPALGEE
GVKDVAHYVMSLSKPKGQYDEERAARGQALFSGPPANCFTCHGDKGQGIQ
GLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY
VWGLSNKDGKAPVKKAEPAPAAEPAPSAPAEAAQAASEAKPAAAEPKAEE
KAAPAAKADGKQVYETVCAACHGNAIPGIPHVGTKADWADRIKKGKDTLH
KHAIEGFNTMPAKGGRGDLSDDEVKAAVDYMVNQSGGKF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGCAACATCCCAATTTACCAGTAATTTCTGGAATATATATATTGC
AGTTATTGTCTTACTGAGCTTTATCGCTTTGGCTTGGCTGCTGCTGTCTC
AAAATGTTGTCAAACGTCCGAAGAAGGGCGAAGAAGTACAAACTACGGGT
CACGAGTGGGACGGCATTGCCGAATACGACAATCCGCTGCCCCGCTGGTG
GTTTTGGCTGTGTGTTTTGACGTGGCTGTTCGGTATCGGTTATCTGGTTA
TGTATCCGGGTGTCGGCGACTACAAAGGTCTGCTGAAATGGACCAGCCAT
AACCAATATGAAAAAGAGGTCAAAAAAGCCGATGAGCAATACGGCAAACT
GTATGCCAAGTTTGCGGATATGCCGATTGAAAAAGTGGCAAAAGACCCAC
AGGCCAAGCAAATCGCCCAAAACCTGTTTAACACTTATTGTATCCAGTGC
CACGGCTCTGATGCCAAAGGTTCTAAAGGTTTTCCGAATCTGACCGATAG
CGATTGGTTGTGGGGCGGCGATCCCGATAAAATCCACGAGACCATCGAAA
AAGGCCGTGTTGCGACTATGCCTGCCTGGGGTCCTGCTTTGGGCGAAGAA
GGCGTGAAAGACGTTGCCCATTATGTGATGTCCCTTTCAAAACCCAAAGG
TCAGTATGATGAGGAACGTGCCGCGCGCGGACAAGCCTTGTTCAGCGGTC
CGCCTGCCAACTGTTTCACTTGCCACGGCGATAAGGGACAAGGTATCCAA
GGTTTGGGTCCGAACCTGACTGATGACGTGTGGTTGTGGGGCGGTACGCA
AAAATCCATTATCGAAACCATTACCAACGGTCGCAGCAGCCAAATGCCCG
CTTGGGGACATTTCTTGGATAAAGACAAACTGCATATCATGACTGCTTAT
GTATGGGGTCTTTCCAATAAAGACGGTAAAGCTCCGGTGAAAAAAGCCGA
GCCTGCACCGGCGGCAGAACCCGCACCATCTGCTCCTGCAGAAGCAGCAC
AAGCCGCTTCTGAAGCCAAACCTGCCGCAGCAGAACCTAAAGCCGAGGAA
AAAGCCGCACCTGCCGCCAAAGCGGATGGCAAACAGGTTTATGAAACCGT
TTGTGCCGCCTGCCATGGCAATGCAATTCCAGGTATTCCCCATGTAGGCA
CCAAAGCCGACTGGGCCGACCGCATCAAAAAAGGTAAGGACACGTTGCAC
AAACACGCGATCGAAGGTTTTAATACGATGCCCGCAAAAGGAGGTCGCGG
CGATTTGAGCGATGATGAGGTCAAAGCTGCGGTTGACTATATGGTCAACC
AGTCAGGCGGTAAGTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy