Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1123 IGR1122 IGR1119 IGR1117 IGR1120 IGR1116 IGR1118 IGR1121 ccoQ, - NG1372 NG1367 ccoO, - NG1373 mtrC,acr, - NG1365 ccoP, - NG1371 NG1370 recC, - NG1369 mtrR,acrR, - NG1366 mtrF, - NG1368 ccoQ, - NG1372 NG1367 ccoO, - NG1373 mtrC,acr, - NG1365 ccoP, - NG1371 NG1370 recC, - NG1369 mtrR,acrR, - NG1366 mtrF, - NG1368 NG1367 ccoO, - NG1373 mtrC,acr, - NG1365 ccoP, - NG1371 NG1370 recC, - NG1369 ccoQ, - NG1372 mtrR,acrR, - NG1366 mtrF, - NG1368
* Calculated from Protein Sequence

Gene ID: NG1369

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recC  

Definition:
exodeoxyribonuclease V gamma subunit

Gene Start:
1333913

Gene Stop:
1330710

Gene Length:
3204

Molecular Weight*:
120003

pI*:
4.90

Net Charge*:
-34.00

EC:
3.1.11.5  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Yeung,T., Mullin,D.A., Chen,K.S., Craig,E.A., Bardwell,J.C. and
Walker,J.R.
Sequence and expression of the Escherichia coli recR locus
J. Bacteriol. 172 (10), 6042-6047 (1990)
M:91008983

Mahdi,A.A. and Lloyd,R.G.
The recR locus of Escherichia coli K-12: molecular cloning, DNA
sequencing and identification of the gene product
Nucleic Acids Res. 17 (17), 6781-6794 (1989)
M:89386036


Comment:
Oklahoma ID: NGO.1369c

For the alpha and beta chains, see NG0771 and NG0370.

For all other 'rec' genes, see NG0318 (recN), NG0370 (recB), NG0414 (recJ), NG0741 (recA), NG0767 (recR), NG0771 (recD), NG1053 (recX), NG0117 (recG), NG1509 (recO), NG1722 (recQ).

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to DNA helicases and exonuclease gamma suunits (RecC). Residues 1-1024 are 29% similar to the DNA helicase RecC in Escherichia coli O157:H7 (gb|AAG57933).

Residues 1-1068 are greater than 90% similar to NMB1720 in N.meningitidis (gb|AAF42066).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1330
COG name: Exonuclease V gamma subunit, RecC
Functional Class:  L
The phylogenetic pattern of COG1330 is --------e-rh----o-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-876 are 30% similar to a (EXODEOXYRIBONUCLEASE V EXONUCLEASE GAMMA CHAIN HYDROLASE) protein domain (PD025681) which is seen in EX5C_ECOLI.

Residues 1-245 are 32% similar to a (EXODEOXYRIBONUCLEASE V GAMMA CHAIN) protein domain (PD148860) which is seen in EX5C_HAEIN.



Paralogs:  Local Blast Search


NG1369 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
654  
705
non-globular  
955  
1015

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFYLYQSNRLESLAALFARIQKVKPLKCALQPEQIVVQSQGMRRYLNTCL
ARDLGVAANLAFSLPAGLTWKLMKKLIPGIPELSPFAPEVMRWRLLDLFR
SAEFQNGAEFEDVRNVLQDYLGSGESADYQLAGQLADIFDQYLVYRPQWI
DAWQQGRILGLGDDEIWQSKLWRYLDDGRQSAPHRVALWEKLLAALDKDK
LPERYFVFGISTMAPMYLQLLHKLSEHCDVFVFALNPSGMHWGNVIEAAQ
ILKGGGDPDLTQAGHPLLASLGKQGRDFFDFLNEMEIEEETPVFEEGGRD
TLLHALQTDIQNLKMPSENVGSVGTDDGSICIVSAHSPLRELQILKDKLL
KILHEHPDWQPHDIAVLTPNIEPYTPFIEAVFGQAQPGAQALPYSVSDVK
ISRRQPFFYALECVSDLLESRFEVGKVLALLETAPVLRRFGLTGDDLPLL
HDMVADLNVHWGLDGEMRGGTDQLFTWKQAADRMILGWMLPEGGNPMWQD
VSAWYADVNQTAMFGRFAAFLETLSDIARIWRQPATVGEWVARCRDLLET
LFQAGPDDQKAVQNLENEWVKWQEESTLAGFFGQLPQQTVIRHIRRFLDS
ESEAGFLRGGITFCSMVPMRSLPFKVICLLGLNDGDFPRNTKAAVFDLVA
KHPAKGDRARRDDDRYLFLEALISAREILYLSYIGRDIRKDEELASSSLL
GELIDTVAAMTGTNSRQLAQNWIEQHPLQAFSRRYFQEGGRSDGIFGTRT
DYAAALGQTPEPPQPFFDQPVENAEPVAEIGQDEFIRFWRNPVKVWLQQL
AWSEPHIGEAWEPAEPFEPQHAEQIAETYIGARREGQDFSQTAARIAAES
LLPSGELGKLWQQSFQTAAKQIDTAVLNSPKLPPFPYAIPSDGQILKGSL
GNLYRCGQVFYAYGKPNAPQRVAFLLEHLIFCAVMPSEAETRQTFIVQSG
ETEVLAEIAQDRALQLLSEWMAFFNIGQNRPLPFFAKTSLAAAEAFAQKQ
DWEAALKKAQTAYYGSKVSKGQKDYTEVALVFGNASQNPLEQPLFENLAR
LLADTLAAAEKREGTGAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTACCTGTACCAATCCAACCGCCTCGAATCGCTCGCTGCACTGTT
TGCCCGCATTCAAAAAGTCAAACCGCTGAAATGTGCCTTGCAGCCCGAAC
AGATTGTTGTGCAGAGCCAGGGGATGCGCCGCTACCTCAACACCTGCCTC
GCCCGCGATTTGGGCGTGGCGGCGAATTTGGCGTTCAGCCTGCCCGCCGG
CCTGACGTGGAAGTTGATGAAAAAACTGATTCCCGGTATTCCGGAACTCA
GCCCGTTTGCACCCGAAGTCATGCGCTGGCGGCTGCTGGATTTGTTCCGC
AGCGCAGAATTTCAAAACGGAGCGGAATTTGAAGATGTGAGGAATGTGCT
GCAAGACTATCTGGGCAGCGGAGAATCGGCGGATTACCAGCTTGCGGGAC
AGCTTGCAGACATATTCGACCAATACCTCGTGTACCGTCCTCAGTGGATA
GACGCTTGGCAGCAGGGCAGGATACTCGGTTTGGGCGACGACGAAATCTG
GCAGTCCAAACTGTGGCGTTACCTCGACGACGGCAGGCAGAGCGCGCCGC
ACCGTGTCGCGTTGTGGGAAAAACTGCTTGCCGCGTTGGACAAGGATAAG
CTGCCCGAGCGTTATTTCGTGTTCGGCATTTCCACGATGGCGCCGATGTA
TTTGCAGCTTTTGCACAAGCTGTCCGAACATTGCGACGTGTTCGTGTTCG
CACTTAATCCGAGCGGGATGCATTGGGGCAACGTCATCGAAGCGGCGCAA
ATCCTCAAAGGCGGCGGCGATCCCGATCTGACGCAGGCAGGGCATCCGCT
GCTTGCCTCATTGGGCAAGCAGGGGCGCGACTTTTTCGACTTTTTGAACG
AAATGGAAATAGAAGAAGAAACGCCGGTATTTGAAGAAGGCGGGCGCGAT
ACGCTTTTGCACGCCCTGCAAACCGATATTCAAAACCTGAAAATGCCGTC
TGAAAATGTGGGAAGCGTCGGTACGGATGACGGCTCGATATGCATCGTAT
CCGCACACAGCCCCTTGCGCGAATTGCAGATACTCAAAGACAAACTGTTG
AAAATTCTGCATGAACATCCCGATTGGCAGCCGCATGATATCGCCGTATT
AACCCCGAATATCGAACCCTATACGCCTTTTATCGAAGCCGTGTTCGGAC
AGGCGCAACCCGGCGCGCAGGCATTGCCGTATTCCGTTTCGGACGTGAAA
ATCAGCCGCCGGCAACCGTTTTTTTATGCGTTGGAGTGCGTGTCCGACTT
GCTGGAAAGCCGTTTTGAAGTCGGCAAAGTGCTCGCGCTTTTGGAAACCG
CGCCCGTGTTGCGCCGTTTCGGACTGACCGGGGACGATTTGCCGCTTTTG
CACGATATGGTTGCCGATTTGAACGTCCATTGGGGATTGGACGGAGAAAT
GCGCGGCGGCACGGATCAGCTGTTTACCTGGAAGCAGGCGGCAGACCGTA
TGATATTGGGCTGGATGCTGCCCGAAGGCGGCAACCCGATGTGGCAGGAT
GTCAGCGCGTGGTATGCCGACGTGAATCAAACCGCCATGTTCGGACGTTT
TGCCGCCTTCCTCGAAACCCTGTCGGATATTGCCCGGATATGGCGGCAAC
CTGCGACGGTCGGCGAATGGGTGGCGCGTTGCCGGGATTTGCTTGAAACA
TTGTTTCAAGCCGGGCCCGATGACCAAAAGGCAGTCCAAAACCTCGAAAA
CGAATGGGTCAAATGGCAGGAAGAGAGCACTTTGGCTGGGTTTTTCGGAC
AGTTGCCGCAACAAACCGTCATCCGCCATATCCGCCGCTTCCTCGACAGC
GAAAGCGAGGCAGGCTTTTTACGCGGCGGCATCACCTTTTGCAGTATGGT
GCCGATGCGCAGCCTGCCCTTTAAAGTCATCTGCCTGTTGGGTTTGAACG
ACGGAGATTTTCCCCGCAATACCAAAGCCGCCGTATTCGACCTGGTTGCC
AAACATCCCGCCAAAGGCGACCGCGCCCGCCGCGACGACGACCGCTACCT
CTTCCTCGAAGCCCTCATCAGCGCGCGCGAAATCCTGTATTTGTCCTACA
TCGGGCGCGACATCCGCAAAGACGAAGAACTGGCTTCGTCTTCCCTGTTG
GGCGAACTCATCGATACCGTTGCCGCCATGACCGGCACAAACAGCCGCCA
ACTTGCACAAAATTGGATAGAACAGCATCCGCTGCAAGCCTTCTCGCGCC
GATATTTCCAAGAAGGCGGACGTTCAGACGGCATATTCGGCACGCGTACC
GACTACGCCGCCGCGCTCGGACAAACGCCCGAACCGCCGCAACCCTTTTT
CGACCAACCCGTAGAAAACGCCGAACCTGTTGCCGAAATCGGACAGGACG
AATTTATCCGCTTCTGGCGCAACCCCGTCAAAGTATGGCTGCAGCAGCTT
GCGTGGAGCGAACCCCATATCGGCGAAGCCTGGGAGCCTGCCGAACCCTT
CGAGCCGCAACACGCGGAGCAAATCGCCGAAACCTATATCGGGGCGCGCC
GCGAAGGACAAGATTTTTCCCAAACCGCCGCCCGTATCGCGGCGGAAAGC
CTGCTGCCTTCCGGAGAATTGGGAAAACTTTGGCAGCAGTCCTTCCAAAC
CGCCGCCAAACAAATCGACACGGCGGTTTTAAACAGCCCCAAACTGCCCC
CGTTTCCATACGCCATACCGTCGGACGGGCAAATCCTGAAAGGCAGCTTG
GGCAATCTGTACCGCTGCGGTCAGGTGTTTTACGCCTACGGCAAACCCAA
TGCGCCGCAACGTGTGGCTTTTTTGTTGGAACACCTGATATTTTGCGCCG
TTATGCCGTCTGAAGCCGAAACGCGGCAAACCTTTATCGTCCAATCCGGA
GAAACAGAAGTATTGGCGGAAATCGCGCAAGACAGGGCATTGCAGCTGTT
GTCGGAATGGATGGCGTTTTTCAATATCGGGCAAAACCGCCCGCTGCCGT
TTTTTGCCAAAACCTCGCTTGCCGCCGCCGAAGCGTTTGCCCAAAAACAA
GATTGGGAAGCCGCCCTGAAAAAAGCCCAAACCGCCTATTACGGCAGCAA
AGTCAGCAAAGGGCAGAAAGACTATACCGAAGTCGCCCTCGTGTTCGGCA
ACGCAAGCCAAAACCCGCTCGAACAGCCCCTGTTTGAAAACCTCGCCCGC
CTGCTCGCCGACACGCTTGCCGCAGCGGAAAAGAGGGAAGGGACCGGAGC
AGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy