Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1110 IGR1108.2 IGR1112 IGR1114 IGR1108.1 IGR1108 IGR1113 IGR1107 IGR1111 IGR1109 nosX, - NG1356 nosX, - NG1355.1 NG1360 thyA, - NG1357 mtrE, - NG1363 mtrD,mexB, - NG1364 NG1362 lldP, - NG1361 icsA,rfaK, - NG1354 gdhA, - NG1358 yocR, - NG1355 nosX, - NG1356 nosX, - NG1355.1 NG1360 thyA, - NG1357 mtrE, - NG1363 mtrD,mexB, - NG1364 NG1362 lldP, - NG1361 icsA,rfaK, - NG1354 gdhA, - NG1358 yocR, - NG1355 nosX, - NG1356 nosX, - NG1355.1 NG1360 thyA, - NG1357 mtrE, - NG1363 mtrD,mexB, - NG1364 NG1359 NG1359 lldP, - NG1361 icsA,rfaK, - NG1354 gdhA, - NG1358 yocR, - NG1355 NG1362
* Calculated from Protein Sequence

Gene ID: NG1358

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gdhA  

Definition:
glutamate dehydrogenase

Gene Start:
1318348

Gene Stop:
1319679

Gene Length:
1332

Molecular Weight*:
48462

pI*:
5.90

Net Charge*:
-3.24

EC:
1.4.1.4  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Glutamate metabolism
Nitrogen metabolism

Secondary Evidence:
Janes,B.K., Pomposiello,P.J., Perez-Matos,A., Najarian,D.J.,
Goss,T.J. and Bender,R.A.
Growth Inhibition Caused by Overexpression of the Structural Gene
for Glutamate Dehydrogenase (gdhA) from Klebsiella aerogenes.
J. Bacteriol. 183 (8), 2709-2714 (2001)
PUBMED: 11274137

Goss TJ, Janes BK, Bender RA.
Repression of glutamate dehydrogenase formation in Klebsiella aerogenes requires two binding sites for the nitrogen assimilation
control protein, NAC.
J Bacteriol. 2002 Dec;184(24):6966-75.
PMID: 12446647

Santos M, Rebordinos L, Gutierrez S, Cardoza RE, Martin JF, Cantoral JM.
Characterization of the gdhA gene from the phytopathogen Botrytis cinerea.
Fungal Genet Biol. 2001 Dec;34(3):193-206.
PMID: 11728157


Comment:
Oklahoma ID: NGO.1358

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to glutamate dehydrogenases. Residues 4-443 are 71% similar to the enzyme from P.aeruginosa (gb|AAG07976).

Residues 1-444 are virtually identical to NMA1964 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0334
COG name: Glutamate dehydrogenase/leucine dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0334 is a--kY-vceBrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001625 (Glutamate/leucine/phenylalanine/valine dehydrogenase) with a combined E-value of 2e-122.
    IPB001625A    76-96
    IPB001625B    106-142
    IPB001625C    155-180
    IPB001625D    191-211
    IPB001625E    229-256
    IPB001625F    341-353
    IPB001625G    361-385


ProDom Summary:  Protein Domain Search
Residues 15-187 are 79% similar to a (DEHYDROGENASE OXIDOREDUCTASE GLUTAMATE NADP NAD) protein domain (PD000880) which is seen in Q9Z3C4_PSEAE.

Residues 190-436 are 60% similar to a (DEHYDROGENASE OXIDOREDUCTASE GLUTAMATE NADP) protein domain (PD000883) which is seen in DHE4_HAEIN.



Paralogs:  Local Blast Search


NG1358 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 54 to 184 (E-value = 3e-74) place NG1358 in the GLFV_dehydrog_N family which is described as Glu/Leu/Phe/Val dehydrogenase, dimerisation domain (PF02812)
Residues 199 to 443 (E-value = 1.9e-131) place NG1358 in the GLFV_dehydrog family which is described as Glutamate/Leucine/Phenylalanine/Valine dehydrogenase (PF00208)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1HRD|1HRD-A 479.0 0e+00
pdb|1K89|1K89 K89L MUTANT OF GLUTAMATE DEHYDROGENASE 475.0 0e+00
pdb|1AUP|1AUP GLUTAMATE DEHYDROGENASE 474.0 0e+00
pdb|2TMG|2TMG-A THERMOTOGA MARITIMA GLUTAMATE DEHYDROGENASE 1

Gene Protein Sequence:
MTDLNTLFANLKQRNPNQEPFHQAVEEVFMSLDPFLAKNPKYTQQSLLER
IVEPERVVMFRVTWQDDKGQVQVNRGYRVQMSSAIGPYKGGLRFHPTVDL
GVLKFLAFEQVFKNALTTLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMTE
LYRHIGADTDVPAGDIGVGGREIGYLFGQYKKIRNEFTSVLTGKGLEWGG
SLIRPEATGYGCVYFAQAMLQTRNDSFEGKRVLISGSGNVAQYAAEKAIQ
LGAKVLTVSDSDGFVLFPDIGMTEAQLAALIELKEVRRERVATYAKEQGL
QYFENQKPWGVAAEIALPCATQNELDEEAAKTLLANGCYVVAEGANMPST
LGAVEQFIKAGILYAPGKASNAGGVATSGLEMSQNAIRLSWAREEVDSRL
FGIMQSIHESCLKYGKVGDKVNYVNGANIAGFVKVADAMLAQGF

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGACCTGAACACCCTGTTTGCCAACCTCAAACAACGCAACCCCAA
TCAGGAGCCGTTCCATCAGGCGGTTGAAGAAGTCTTCATGAGCCTTGATC
CGTTTTTGGCAAAAAATCCGAAATACACCCAGCAAAGCCTGCTGGAACGC
ATCGTCGAACCCGAACGCGTCGTGATGTTCCGCGTAACCTGGCAGGACGA
CAAAGGACAAGTCCAAGTCAACCGCGGCTACCGCGTGCAAATGAGTTCCG
CCATCGGCCCTTACAAAGGCGGCCTGCGCTTCCACCCGACCGTCGATTTG
GGCGTGTTGAAATTCCTCGCTTTTGAACAAGTGTTCAAAAACGCCTTGAC
CACCCTGCCTATGGGCGGCGGCAAAGGCGGTTCCGACTTCGACCCCAAAG
GCAAATCCGATGCCGAAGTAATGCGCTTCTGCCAAGCCTTTATGACCGAA
CTCTACCGCCACATCGGCGCGGACACCGATGTTCCGGCCGGCGACATCGG
CGTAGGCGGACGCGAAATCGGCTACCTGTTCGGACAATACAAAAAAATCC
GCAATGAATTCACTTCCGTCCTGACCGGCAAAGGTTTGGAATGGGGTGGC
AGCCTCATCCGCCCCGAGGCGACCGGCTACGGCTGCGTCTATTTCGCCCA
AGCGATGCTGCAAACCCGCAACGATAGTTTTGAAGGCAAACGCGTTCTGA
TTTCCGGTTCCGGCAACGTGGCGCAATACGCCGCTGAAAAAGCCATCCAA
CTGGGTGCGAAAGTGCTGACCGTCTCCGACTCCGACGGCTTCGTCCTCTT
CCCCGACATCGGTATGACCGAAGCGCAACTCGCCGCCTTGATCGAATTGA
AAGAAGTCCGCCGCGAACGCGTTGCCACCTACGCCAAAGAGCAAGGTTTG
CAATACTTTGAAAACCAAAAACCGTGGGGCGTTGCCGCCGAAATCGCCCT
GCCCTGCGCGACCCAGAACGAATTGGACGAAGAAGCCGCCAAAACCCTGT
TGGCAAACGGCTGCTACGTCGTTGCCGAAGGCGCGAATATGCCGTCGACT
TTGGGCGCGGTCGAGCAATTTATCAAAGCCGGCATCCTCTACGCTCCGGG
CAAAGCCTCCAACGCCGGCGGCGTGGCAACTTCGGGCTTGGAAATGAGCC
AAAACGCCATCCGCCTGTCTTGGGCGCGCGAAGAAGTGGACAGCCGACTG
TTCGGCATCATGCAAAGCATCCACGAGTCCTGCCTGAAATACGGCAAAGT
CGGCGACAAAGTGAACTACGTCAACGGTGCGAACATCGCCGGCTTCGTCA
AAGTTGCCGATGCGATGCTGGCGCAAGGCTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy