Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1110 IGR1106 IGR1108.2 IGR1112 IGR1108.1 IGR1108 IGR1113 IGR1107 IGR1111 IGR1105 IGR1109 nosX, - NG1356 nosX, - NG1355.1 NG1360 thyA, - NG1357 mtrE, - NG1363 NG1362 lldP, - NG1361 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 gdhA, - NG1358 yocR, - NG1355 nosX, - NG1356 nosX, - NG1355.1 NG1360 thyA, - NG1357 mtrE, - NG1363 NG1362 lldP, - NG1361 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 gdhA, - NG1358 yocR, - NG1355 nosX, - NG1356 nosX, - NG1355.1 NG1360 thyA, - NG1357 mtrE, - NG1363 NG1359 NG1359 lldP, - NG1361 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 gdhA, - NG1358 yocR, - NG1355 NG1362
* Calculated from Protein Sequence

Gene ID: NG1357

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thyA  

Definition:
thymidylate synthase A

Gene Start:
1317930

Gene Stop:
1317133

Gene Length:
798

Molecular Weight*:
30496

pI*:
6.30

Net Charge*:
-3.73

EC:
2.1.1.45  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Folate biosynthesis
One carbon pool by folate
Pyrimidine metabolism

Primary Evidence:
Carlson,J.H. and Hill,S.A.
Identification and characterization of thymidylate synthase from
Neisseria gonorrhoeae. FEMS Microbiol. Lett. 151 (2), 225-230 (1997)
M:97372537


Secondary Evidence:
Myllykallio H, Lipowski G, Leduc D, Filee J, Forterre P, Liebl U. An alternative flavin-dependent mechanism for thymidylate synthesis.
Science. 2002 Jul 5;297(5578):105-7.
PMID: 12029065

Viswanathan M, Lacirignola JJ, Hurley RL, Lovett ST.
A novel mutational hotspot in a natural quasipalindrome in
Escherichia coli.
J Mol Biol. 2000 Sep 22;302(3):553-64.
PMID: 10986118

Fu X, Xu JG.
Development of a chromosome-plasmid balanced lethal system for Lactobacillus acidophilus with thyA gene as selective marker. Microbiol Immunol. 2000;44(7):551-6.
PMID: 10981827

Comment:
Oklahoma ID: NGO.1357c

Blast Summary:  PSI-Blast Search
NG1357 is 98% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 2258280, a predicted thymidylate synthetase.

Numerous matches to thmidylate synthase sequences in gapped BLAST. Residues 3-266 are 81% similar to the enzyme in P.aeruginosa (gb|AAG03731).

Residues 1-266 are virtually identical to NMA1963 in N.meningitidis ((AL162757).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0207
COG name: Thymidylate synthase
Functional Class:  F
The phylogenetic pattern of COG0207 is amt-y---eBrh--gp-----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000398 (Thymidylate synthase) with a combined E-value of 3.2e-154.
    IPB000398A    5-33
    IPB000398B    44-70
    IPB000398C    90-103
    IPB000398D    111-152
    IPB000398E    153-207
    IPB000398F    243-266


ProDom Summary:  Protein Domain Search
Residues 6-211 are 25% similar to a (TRANSFERASE METHYLTRANSFERASE THYMIDYLATE SYNTHASE TS) protein domain (PD150895) which is seen in DUHM_BPSP1.

Residues 22-215 are 24% similar to a (DEOXYCYTIDYLATE HYDROXYMETHYLTRANSFERASE) protein domain (PD023730) which is seen in DCHM_BPT2.

Residues 4-266 are 98% similar to a (SYNTHASE THYMIDYLATE TRANSFERASE METHYLTRANSFERASE) protein domain (PD001180) which is seen in O33380_NEIGO.



Paralogs:  Local Blast Search


NG1357 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 266 (E-value = 1.8e-185) place NG1357 in the Thymidylat_synt family which is described as Thymidylate synthase (PF00303)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
172  
188

PDB Hit:
pdb|1AN5|1AN5-A E. COLI THYMIDYLATE SYNTHASE IN COMPLEX WITH 411.0 0e+00
pdb|2TSC|2TSC-A THYMIDYLATE SYNTHASE (E.C.2.1.1.45) COMPLEX WITH410.0 0e+00
pdb|1F4B|1F4B-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 409.0 0e+00
pdb|1BQ2|1BQ2 E. CO

Gene Protein Sequence:
MMMKAYLDLMRHVLDNGTDKSDRTGTGTRSVFGYQMRFDLGKGFPLLTTK
KLHLRSIIHELLWFLKGDTNIKYLKDNNVSIWDEWADENGDLGPVYGYQW
RSWPAPDGRHIDQIANVVEQIKKNPDSRRLIVSAWNPALVDEMALPPCHA
LFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTMMMAQVCGLEAGE
FVHTFGDAHLYRNHFEQAALQLEREPRALPVMKINPEVKDLFAFKFEDFE
LEGYDPHPHIKAVVSV

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGATGAAGGCCTATTTGGACTTGATGCGCCACGTCCTCGACAACGG
TACGGACAAATCAGACCGCACCGGTACGGGTACGCGCTCCGTATTCGGTT
ATCAGATGCGTTTTGACTTGGGCAAAGGTTTTCCGCTGCTGACGACCAAA
AAGCTGCATTTGCGCTCGATAATCCACGAGCTGCTTTGGTTCCTCAAAGG
CGATACCAATATCAAATACCTGAAGGATAACAATGTTTCCATTTGGGACG
AGTGGGCGGACGAAAACGGCGACTTGGGCCCGGTTTACGGCTACCAATGG
CGCAGCTGGCCCGCGCCCGACGGCAGGCATATCGACCAAATCGCCAATGT
GGTGGAACAAATTAAGAAAAACCCCGACTCGCGCCGCCTGATTGTGTCGG
CGTGGAATCCGGCTTTGGTCGATGAGATGGCCTTGCCGCCCTGCCACGCG
CTGTTTCAGTTTTACGTTGCCGACGGCAAACTGTCCTGCCAGCTTTACCA
GCGTAGTGCAGATATTTTCCTTGGTGTGCCGTTTAATATTGCCAGCTACG
CGCTGTTGACGATGATGATGGCGCAAGTGTGCGGGCTGGAGGCGGGCGAG
TTTGTCCATACGTTTGGCGACGCGCATTTGTACCGTAACCATTTCGAACA
GGCCGCATTGCAGTTGGAACGCGAACCGCGCGCCTTGCCTGTGATGAAAA
TCAATCCTGAAGTCAAGGATTTGTTTGCCTTCAAGTTTGAAGATTTCGAG
TTGGAAGGCTACGATCCGCATCCGCACATCAAGGCGGTAGTGTCGGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy