Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Met-1 IGR1106 IGR1100 IGR1108.2 IGR1101 IGR1104 IGR1102 IGR1104.1 IGR1108.1 IGR1108 IGR1103 IGR1107 IGR1105 NG1348 NG1347 nosX, - NG1356 nosX, - NG1355.1 NG1346 NG1349 thyA, - NG1357 acpP,fabG, - NG1351 NG1350 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 fabF2, - NG1352 yocR, - NG1355 NG1348 NG1347 nosX, - NG1356 nosX, - NG1355.1 NG1346 NG1349 thyA, - NG1357 acpP,fabG, - NG1351 NG1350 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 fabF2, - NG1352 yocR, - NG1355 nosX, - NG1356 nosX, - NG1355.1 NG1346 NG1349 thyA, - NG1357 NG1347 NG1348 acpP,fabG, - NG1351 NG1350 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 fabF2, - NG1352 yocR, - NG1355
* Calculated from Protein Sequence

Gene ID: NG1353

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lgtF  icsB  

Definition:
beta-1,4-glycosyltransferase; LPS glycosyltransferase

Gene Start:
1312534

Gene Stop:
1313295

Gene Length:
762

Molecular Weight*:
29540

pI*:
9.60

Net Charge*:
8.98

EC:
2.-.-.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Primary Evidence:
Kahler,C.M., Carlson,R.W., Rahman,M.M., Martin,L.E. and Stephens,D.S.
Two glycosyltransferase genes, lgtF and rfaK, constitute the
lipooligosaccharide ice (inner core extension) biosynthesis operon of Neisseria meningitidis.
J. Bacteriol. 178 (23), 6677-6684 (1996)
Medline: 97113422

Comment:
For other 'lgt' genes see NG0846 (lgt),NG2072 (lgtG),
NG2156(lgtB), NG2158 (lgtD), NG2159 (lgtE).


Oklahoma ID: NGO.1353

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to beta 1,4 glycosyltransferases. Residues 3-244 are 34% similar to the enzyme from A.aeolicus (gb|AAC07593).

Residues 1-254 are 94% similar to NMA1958 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0463
COG name: Glycosyltransferases involved in cell wall biogenesis
Functional Class:  M
The phylogenetic pattern of COG0463 is AMTKYQVCEBRHujGPo---X
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-58 are 96% similar to a (PROTEIN TRANSFERASE GLYCOSYLTRANSFERASE PUTATIVE) protein domain (PD000196) which is seen in P95373_NEIME.

Residues 77-245 are 96% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE BETA) protein domain (PD011199) which is seen in P95373_NEIME.



Paralogs:  Local Blast Search


NG1353 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 182 (E-value = 1.6e-26) place NG1353 in the Glycos_transf_2 family which is described as Glycosyl transferase (PF00535)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
61

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LIMKKVSVLIVAKNEANHIRECIESCRFDKEVIVIDDHSADNTAEIAEGL
GAKVFRRHLNGDFGAQKTFAIEQAGGEWVFLIDADERCTPELSDEISKIV
RTGDYAAYFVERRNLFPNHPATHGAMRPDSVCRLMPKKGGSVQGKVHETV
QTPYPERRLKHFMYHYTYDNWEQYFNKFNKYTSISAEKYREQGKPVSFVR
DIILRPIWGFFKIYILNKGFLDGKMGWIMSVNHSYYTMIKYVKLYYLYKS
GGKF

Gene Nucleotide Sequence:  Sequence Viewer
TTGATAATGAAAAAAGTCAGCGTATTGATTGTTGCCAAAAACGAAGCAAA
CCACATTCGGGAATGTATTGAAAGTTGCCGTTTCGATAAAGAAGTTATCG
TTATCGACGACCATAGCGCCGACAACACTGCCGAAATTGCCGAGGGTTTG
GGTGCAAAAGTCTTCAGACGGCATTTGAACGGGGATTTCGGAGCGCAAAA
AACATTTGCCATCGAACAGGCAGGCGGAGAATGGGTTTTCCTGATTGATG
CAGACGAACGCTGCACGCCGGAACTATCTGATGAAATCTCAAAAATTGTC
CGAACCGGCGATTATGCCGCCTATTTTGTCGAACGCCGCAACCTTTTCCC
CAACCATCCCGCCACACACGGCGCGATGCGTCCCGACAGCGTATGCCGTC
TGATGCCGAAAAAAGGCGGTTCGGTGCAAGGCAAAGTACACGAAACCGTA
CAGACCCCCTACCCCGAACGCCGTCTGAAACATTTTATGTACCATTACAC
GTACGACAACTGGGAACAATATTTCAACAAGTTCAACAAATATACTTCCA
TCTCGGCCGAGAAATACCGGGAGCAGGGAAAGCCCGTGAGTTTCGTTAGG
GACATTATCCTCCGTCCGATTTGGGGTTTTTTCAAAATTTATATCCTGAA
CAAAGGGTTTCTTGATGGAAAAATGGGTTGGATTATGTCCGTCAACCACA
GCTATTACACGATGATTAAATATGTCAAACTATATTATCTGTACAAATCC
GGCGGAAAATTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy