Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Met-1 IGR1106 IGR1100 IGR1099 IGR1101 IGR1104 IGR1102 IGR1104.1 IGR1108.1 IGR1108 IGR1103 IGR1107 IGR1105 NG1348 NG1347 nosX, - NG1355.1 NG1346 NG1349 NG1345 acpP,fabG, - NG1351 NG1350 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 fabF2, - NG1352 yocR, - NG1355 NG1348 NG1347 nosX, - NG1355.1 NG1346 NG1349 NG1345 acpP,fabG, - NG1351 NG1350 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 fabF2, - NG1352 yocR, - NG1355 nosX, - NG1355.1 NG1346 NG1349 NG1345 NG1347 NG1348 acpP,fabG, - NG1351 NG1350 lgtF,icsB, - NG1353 icsA,rfaK, - NG1354 fabF2, - NG1352 yocR, - NG1355
* Calculated from Protein Sequence

Gene ID: NG1352

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabF2  

Definition:
probable 3-oxoacyl-(acyl-carrier-protein) synthase

Gene Start:
1311105

Gene Stop:
1312244

Gene Length:
1140

Molecular Weight*:
41837

pI*:
11.50

Net Charge*:
32.03

EC:
2.3.1.41  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Secondary Evidence:
Summers,R.G., Ali,A., Shen,B., Wessel,W.A. and Hutchinson,C.R.
Malonyl-coenzyme A:acyl carrier protein acyltransferase of
Streptomyces glaucescens: a possible link between fatty acid and
polyketide biosynthesis
Biochemistry 34 (29), 9389-9402 (1995)
Medline: 95352622


Comment:
For other 'Fab' genes see NG1666 (FabI),NG1763 (fabF),NG1804 (fabZ), NG2163 (fabG), NG2166 (fabD) and NG2168 (fabH).

Oklahoma ID: NGO.1352

Blast Summary:  PSI-Blast Search
Residues 1-294 are 54% similar to 3-oxoacyl-(acyl-carrier-protein) synthase II in Neisseria meningitidis group B strain MD58 (11257677|).

Numerous hits in gapped BLAST to 3-oxoacyl-[acyl-carrier-protein] synthase / beta-ketoacyl-ACP synthase sequences,e.g.residues 10-235 are 36% similar to a putative 3-oxoacyl-(acyl-carrier-protein) synthase II in Escherichia coli O157:H7 (13363815|).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0304
COG name: 3-oxoacyl-(acyl-carrier-protein) synthase I
Functional Class:  I
The phylogenetic pattern of COG0304 is ----YqvCEBRhuj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-111 are 61% similar to a (BETA-KETOACYL-ACP SYNTHASE IV) protein domain (PD091330) which is seen in P70719_BBBBB.

Residues 199-235 are 75% similar to a (SYNTHASE TRANSFERASE POLYKETIDE BIOSYNTHESIS) protein domain (PD000224) which is seen in P70719_BBBBB.



Paralogs:  Local Blast Search


NG1352 is paralogously related to NG1763 (3-oxoacyl-[acyl-carrier-protein] synthase II) (2e-17).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
380

PDB Hit:
pdb|1B3N|1B3N-A BETA-KETOACYL CARRIER PROTEIN SYNTHASE AS A DRUG 73.4 7e-14
pdb|1E5M|1E5M-A BETA KETOACYL ACYL CARRIER PROTEIN SYNTHASE II 63.6 6e-11
pdb|1FJ4|1FJ4-A THE STRUCTURE OF BETA-KETOACYL-[ACYL CARRIER 60.1 7e-10
pdb|1DD8|1DD8-A CRYS

Gene Protein Sequence:
MDWRERFPELEAQLDAPIEDYAPPKHWTRKRLRSMGRVSYLCVDAAEQAL
MDAGLLGDESITDGRMGVACGSSGGGTKDIGDVGELLLTGTSRNFGANTY
VRMMPHTADANIGIFFGLTRTHHPDIERVFFGQPRHRLCLRGHQIRSDRY
DAGGRRRRILPVRSVCFRLALCRQPPQRRTGRDPASIRREPRRAGHRRKG
AGIFVLEELEHAKRRGAKIYAELVGYGANSDGINIGEGAAVFIMTRDADF
SGGMQLLGYGASSDAYHISTPRPDAKAQSSPFRRHCSTPALRPKTSAGLI
CTAPGRTTTTVWKAAPLQRFSATIRPARPPSRKPDTRWARRAQSKPRSRG
ALPTGKAIPKGNFRPGFGTGRTTPTCPPLT

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTGGCGCGAACGTTTCCCCGAATTGGAAGCGCAACTGGATGCGCC
GATTGAGGATTACGCGCCGCCGAAACATTGGACGCGCAAGCGGCTCAGAA
GTATGGGGCGCGTGTCGTACCTGTGCGTCGATGCGGCGGAGCAGGCTTTG
ATGGATGCAGGTTTGCTCGGGGACGAAAGCATTACCGACGGACGGATGGG
CGTTGCCTGCGGCTCTTCCGGCGGCGGCACCAAAGACATCGGAGATGTGG
GAGAATTGTTGCTGACCGGCACGTCGCGCAACTTCGGCGCCAATACCTAT
GTGCGTATGATGCCGCACACCGCCGACGCCAATATCGGCATCTTTTTCGG
ATTAACAAGGACGCATCATCCCGACATCGAGCGCGTGTTCTTCGGGCAGC
CAAGGCATAGGTTATGCTTACGAGGCCATCAAATACGGTCTGACCGATAT
GATGCTGGCGGGCGGCGGCGAAGAATTTTGCCCGTCCGAAGTGTATGTTT
TCGACTCGCTCTATGCCGCCAGCCGCCGCAACGGCGAACCGGAAGAGACC
CCGCGTCCATACGACGCGAACCGCGACGGGCTGGTCATCGGAGAAAAGGC
GCGGGGATTTTCGTATTGGAAGAATTGGAACACGCCAAACGGCGCGGTGC
GAAAATTTACGCCGAACTCGTCGGCTACGGCGCCAACAGCGACGGCATCA
ATATCGGCGAAGGCGCAGCCGTATTCATCATGACGCGCGATGCGGATTTT
TCCGGCGGTATGCAGCTTCTGGGTTACGGCGCAAGCAGCGATGCCTACCA
TATTTCCACGCCCCGCCCCGACGCAAAGGCGCAATCCTCGCCTTTCAGAC
GGCATTGCAGCACGCCGGCCTTGCGCCCGAAGACATCGGCCGGATTAATC
TGCACGGCACCGGGACGCACCACAACGACAGTATGGAAAGCCGCGCCGTT
GCAGCGGTTTTCGGCAACAATACGCCCTGCACGTCCGCCAAGCCGCAAAC
CGGACACACGCTGGGCGCGGCGGGCGCAATCGAAGCCGCGTTCGCGTGGG
GCATTGCCGACCGGCAAAGCAATCCCGAAGGGAAACTTCCGCCCCGGCTT
TGGGACGGGCAGAACGACCCCGACCTGCCCGCCATTAACC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy