Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1098 IGR1093 IGR1097 IGR1092 IGR1095 IGR1096 IGR1094 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 prfA, - NG1337 mrsA, - NG1341 NG1345 NG1344 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 prfA, - NG1337 mrsA, - NG1341 NG1345 NG1344 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 prfA, - NG1337 mrsA, - NG1341 NG1345 NG1338 NG1338 NG1344
* Calculated from Protein Sequence

Gene ID: NG1342

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dhpS  folP  

Definition:
dihydropteroate synthase

Gene Start:
1302853

Gene Stop:
1302002

Gene Length:
852

Molecular Weight*:
30366

pI*:
5.50

Net Charge*:
-6.39

EC:
2.5.1.15  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Folate biosynthesis

Primary Evidence:
Radstrom,P., Fermer,C., Kristiansen,B.E., Jenkins,A., Skold,O. and
Swedberg,G.
Transformational exchanges in the dihydropteroate synthase gene of
Neisseria meningitidis: a novel mechanism for acquisition of
sulfonamide resistance. J. Bacteriol. 174 (20), 6386-6393 (1992)
M:93015687


Comment:
Oklahoma ID: NGO.1342c

For other 'fol' genes, see NG0267 (folI), NG0323 (folK), NG0857 (folB), NG0266 (folC), NG1694 (folA), NG1999 (folD).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to dihydropteroate synthase sequences. Residues 17-280 are 45% simmlar to the enzyme from Caulobacter crescentus (gb|AAK25186).

Residues 5-283 are virtually identical to NMA1950 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0294
COG name: Dihydropteroate synthase
Functional Class:  H
The phylogenetic pattern of COG0294 is amtkyqvCebRHuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000489 (Dihydropteroate synthase) with a combined E-value of 2.5e-68.
    IPB000489A    20-35
    IPB000489B    44-86
    IPB000489C    181-198
    IPB000489D    217-232
    IPB000489E    258-267


ProDom Summary:  Protein Domain Search
Residues 21-279 are 88% similar to a (DIHYDROPTEROATE SYNTHASE DHPS PYROPHOSPHORYLASE) protein domain (PD001976) which is seen in DHPS_NEIME.



Paralogs:  Local Blast Search


NG1342 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 23 to 235 (E-value = 6.7e-104) place NG1342 in the Pterin_bind family which is described as Pterin binding enzyme (PF00809)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
43  
144
non-globular  
205  
284

PDB Hit:
pdb|1AJ0|1AJ0 CRYSTAL STRUCTURE OF A TERNARY COMPLEX OF E. COLI204.0 1e-53
pdb|1EYE|1EYE-A 1.7 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF 6- 173.0 3e-44
pdb|1AD1|1AD1-A DIHYDROPTEROATE SYNTHETASE (APO FORM) FROM 144.0 2e-35
pdb|1AJ0|1AJ0 CRYST

Gene Protein Sequence:
MARHVWRAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAER
LLKEGADILDIGGESTRPGADFVPPEEEEWARVEPVLAEAAGWGVPVSLD
TRRTVVMEKALALGGIDIINDVAALTDEGAVELLARQADTGICLMHMRGL
PETMQDNPKYQDVVGEVARYLKTRSETCVAAGIAPQRITLDPGFGFGKNL
QHNIALMRHLPELMAETGLPLLIGVSRKRMIGELTGEADAAARVHGSVAA
ALASVARGAQIVRVHDVKATADALKVWEALGVNR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACGACACGTTTGGCGGGCAGGACGGTTTGAAATCGGTTTGGACAA
ACCGAAAATCATGGGCATCGTGAATCTCACGCCCGATTCTTTTTCCGACG
GCGGCGCGTATTCGCAAAACGCCCAAACAGCTTTGGCGCATGCCGAACGG
CTTTTGAAAGAGGGTGCGGACATTCTCGACATCGGCGGCGAATCGACGCG
GCCGGGTGCGGATTTCGTTCCGCCCGAAGAAGAAGAATGGGCGCGGGTTG
AGCCTGTATTGGCGGAAGCGGCGGGGTGGGGCGTTCCCGTCAGTTTGGAC
ACGCGCCGCACGGTGGTTATGGAAAAGGCGTTGGCACTCGGCGGCATCGA
TATTATCAATGATGTGGCGGCGTTGACCGACGAAGGTGCGGTCGAATTGC
TGGCGCGCCAGGCGGACACGGGCATTTGCCTGATGCATATGCGGGGCTTG
CCCGAAACCATGCAGGACAATCCGAAATATCAGGATGTGGTCGGCGAAGT
GGCACGTTATCTGAAAACACGGTCAGAAACCTGTGTCGCGGCAGGCATCG
CGCCGCAACGGATTACGCTCGACCCGGGTTTCGGCTTCGGCAAGAACCTG
CAACACAATATCGCACTGATGCGGCATTTGCCCGAATTGATGGCGGAAAC
CGGTTTGCCGCTGCTGATCGGTGTGTCGCGCAAACGCATGATAGGTGAGC
TGACCGGTGAGGCGGACGCGGCGGCGCGCGTACACGGCAGCGTGGCAGCG
GCTTTGGCTTCCGTGGCACGCGGAGCGCAAATCGTGCGCGTGCACGATGT
GAAGGCGACGGCGGACGCGTTGAAGGTGTGGGAAGCGTTGGGCGTGAACC
GG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy