Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1098 IGR1093 IGR1097 IGR1092 IGR1091 IGR1095 IGR1096 IGR1094 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 NG1345 NG1344 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 NG1345 NG1344 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 NG1345 NG1338 NG1338 NG1344
* Calculated from Protein Sequence

Gene ID: NG1341

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mrsA  

Definition:
phosphoglucomutase/phosphomannomutase family

Gene Start:
1301872

Gene Stop:
1300538

Gene Length:
1335

Molecular Weight*:
47943

pI*:
5.80

Net Charge*:
-5.52

EC:
5.4.2.2  5.4.2.8  

Functional Class:
Central intermediary metabolism; Amino sugars  
Energy metabolism; Sugars  

Pathway: pathway table
Aminosugars metabolism
Erythromycin biosynthesis
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle
Starch and sucrose metabolism
Streptomycin biosynthesis

Primary Evidence:
Zhou,D., Stephens,D.S., Gibson,B.W., Engstrom,J.J.,
McAllister,C.F., Lee,F.K. and Apicella,M.A.
Lipooligosaccharide biosynthesis in pathogenic Neisseria. Cloning,
identification, and characterization of the phosphoglucomutase gene
J. Biol. Chem. 269 (15), 11162-11169 (1994)
M:94209286


Comment:
Oklahoma ID: NGO.1341c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to phophoglucomutases and MRSA proteins. Residues 1-429 are 57% similar to MRSA_HAEIN
(gb|AAC23110).

Residues 2-430 are virtually identical to NMB1690 in N.meningitidis (gb|AAF42038).

COGS Summary:  COGS Search
BeTs to 16 clades of COG1109
COG name: Phosphomannomutase
Functional Class:  G
The phylogenetic pattern of COG1109 is aMTKYQVCEBRHUJgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 331-429 are 50% similar to a (PHOSPHOMANNOMUTASE PROTEIN ISOMERASE PHOSPHORYLATION PMM) protein domain (PD001709) which is seen in MRSA_HAEIN.

Residues 21-308 are 22% similar to a (MANNOSE-1-PHOSPHATE GUANYLTRANSFERASE TRANSFERASE) protein domain (PD041662) which is seen in P74589_SYNY3.

Residues 7-127 are 66% similar to a (ISOMERASE PHOSPHOMANNOMUTASE PHOSPHORYLATION) protein domain (PD000667) which is seen in MRSA_HAEIN.

Residues 161-330 are 58% similar to a (ISOMERASE PHOSPHORYLATION PHOSPHOMANNOMUTASE) protein domain (PD000778) which is seen in MRSA_HAEIN.



Paralogs:  Local Blast Search


NG1341 is paralogously related to NG0375 (phosphoglucomutase (glucose phosphomutase)) (8e-27).


Pfam Summary:  Pfam Search
Residues 4 to 143 (E-value = 1.5e-61) place NG1341 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)
Residues 159 to 259 (E-value = 3.6e-36) place NG1341 in the PGM_PMM_II family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II (PF02879)
Residues 261 to 372 (E-value = 1.1e-25) place NG1341 in the PGM_PMM_III family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III (PF02880)
Residues 376 to 444 (E-value = 4.6e-10) place NG1341 in the PGM_PMM_IV family which is described as Phosphoglucomutase/phosphomannomutase, C-terminal domain (PF00408)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
61  
77
non-globular  
389  
445

PDB Hit:
pdb|1K2Y|1K2Y-X CRYSTAL STRUCTURE OF 122.0 2e-28
pdb|1K35|1K35-A CRYSTAL STRUCTURE OF 121.0 2e-28
pdb|1C47|1C47-A BINDING DRIVEN STRUCTURAL CHANGES IN CRYSTALINE 56.6 9e-09
pdb|1JDY|1JDY-A RABB

Gene Protein Sequence:
MMAKKYFGTDGVRGEVGQFPITPDFVLKLGYAAGQVLVQHDTDQKPTVLI
GKDTRISGYMLEAALVAGFTAAGVNVVQTGPLPTPGVAYLTRALRLSAGV
MISASHNTYSDNGIKFFAEGGVKLSDEVELEIEAKIDEEMKTQPSARLGR
ARRISGADDRYIEFCKSTFPGHSDLRGLKLVIDTANGAGYGVAPKVFHEL
GAQVVSIGNEPNGYNINEKCGATHTKTLQAAVLQNEADYGIALDGDGDRL
MMVDKNRQVYDGDSLIYVIAKARAREGINIGGVVGTVMTNMAMEIALKEQ
GVDFCRAKVGDRYVLEQLNQRGWLIGGEASGHILCMDKHNTGDGIISALQ
VLAALQILNQDLATVCADWQPYPQTMINVRIQKGQKWQEASKDVLAEVEK
ELEGKGRVVLRASGTEPVVRVMVEARQADWARDGAERIAAAIGGI

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGGCAAAAAAATATTTCGGCACGGACGGCGTGCGCGGCGAAGTCGG
TCAGTTTCCGATTACGCCCGATTTTGTATTGAAACTCGGCTATGCGGCGG
GGCAGGTGCTGGTGCAGCACGATACCGATCAGAAACCGACCGTCCTCATC
GGCAAAGACACGCGCATTTCAGGCTATATGCTGGAAGCCGCGCTGGTAGC
GGGCTTTACGGCGGCGGGTGTGAATGTGGTACAGACCGGGCCGTTGCCCA
CGCCCGGTGTGGCTTATCTGACCCGCGCATTGCGCCTGTCCGCCGGCGTG
ATGATTTCCGCGTCGCACAACACCTATTCCGACAACGGCATCAAATTCTT
TGCCGAAGGCGGCGTGAAACTTTCCGATGAAGTCGAGTTGGAAATCGAAG
CCAAAATCGATGAAGAAATGAAAACCCAACCGTCCGCACGTCTCGGACGC
GCCCGCCGCATCAGCGGTGCGGACGACCGCTATATCGAGTTTTGCAAATC
CACCTTCCCCGGCCATTCCGACCTTCGGGGTTTGAAGTTGGTTATCGATA
CCGCCAACGGTGCAGGATACGGCGTTGCACCCAAAGTGTTCCACGAACTC
GGCGCACAGGTCGTCAGCATCGGCAACGAACCCAACGGCTACAACATCAA
CGAAAAATGCGGCGCGACCCATACCAAAACCCTCCAAGCCGCCGTGTTGC
AAAACGAAGCCGATTACGGTATTGCCTTGGACGGCGATGGCGACCGCCTG
ATGATGGTCGATAAAAACAGGCAGGTTTACGACGGCGACAGCCTGATTTA
CGTCATCGCCAAAGCCCGCGCCCGAGAAGGTATCAACATCGGCGGCGTGG
TCGGAACGGTCATGACCAATATGGCGATGGAAATCGCCCTGAAAGAGCAG
GGCGTCGATTTCTGCCGCGCCAAAGTCGGCGACCGCTATGTGTTGGAACA
GCTGAACCAACGCGGCTGGCTCATCGGCGGCGAAGCCAGCGGCCATATTT
TGTGCATGGACAAACATAACACCGGCGACGGCATTATTTCCGCGCTGCAA
GTCTTGGCGGCGCTGCAAATCCTGAACCAAGACCTCGCCACCGTTTGCGC
CGACTGGCAGCCGTATCCGCAAACGATGATTAACGTGCGCATCCAAAAGG
GTCAGAAATGGCAGGAGGCTTCGAAAGACGTGTTGGCCGAAGTGGAAAAA
GAACTCGAAGGCAAAGGGCGTGTCGTGTTGCGCGCTTCGGGAACCGAACC
CGTCGTGCGCGTGATGGTCGAGGCGCGTCAGGCCGATTGGGCGCGCGACG
GGGCGGAGCGTATCGCCGCCGCCATCGGCGGCATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy