Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1093 IGR1090 IGR1089 IGR1097 IGR1092 IGR1091 IGR1095 IGR1096 IGR1094 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 serS, - NG1335 NG1344 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 serS, - NG1335 NG1344 dedA, - NG1340 dhpS,folP, - NG1342 aroQ,pheA, - NG1343 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 NG1338 NG1338 serS, - NG1335 NG1344
* Calculated from Protein Sequence

Gene ID: NG1339

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ansA  

Definition:
L-asparaginase

Gene Start:
1299596

Gene Stop:
1298607

Gene Length:
990

Molecular Weight*:
34878

pI*:
4.80

Net Charge*:
-9.74

EC:
3.5.1.1  

Functional Class:
Energy metabolism; Amino acids and amines  

Pathway: pathway table
Alanine and aspartate metabolism
Cyanoamino acid metabolism
Nitrogen metabolism

Secondary Evidence:
Jerlstrom,P.G., Bezjak,D.A., Jennings,M.P. and Beacham,I.R.
Structure and expression in Escherichia coli K-12 of the
L-asparaginase I-encoding ansA gene and its flanking regions.
Gene 78 (1), 37-46 (1989)
M:89357501

Kelo E, Noronkoski T, Stoineva IB, Petkov DD, Mononen I.
Beta-aspartylpeptides as substrates of L-asparaginases from Escherichia coli and Erwinia chrysanthemi.
FEBS Lett. 2002 Sep;528(1-3):130-2.
PMID: 12297292

Sanches M, Barbosa J JA, De Oliveira RT, Abrahão Neto J, Polikarpov I.
Structural comparison of Escherichia coli L-asparaginase in two monoclinic space groups.
Acta Crystallogr D Biol Crystallogr. 2003 Mar;59(Pt 3):416-22.
PMID: 12595697

Comment:
Oklahoma ID: NGO.1339c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to L-asparaginase sequences. Residues 2-326 are 31% similar to ASG1_ECOLI (gb|AAC74837).

Residues 1-329 are greater than 90% similar to NMA1947 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0252
COG name: L-asparaginase
Functional Class:  E
The phylogenetic pattern of COG0252 is amtKY---EBrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000267 (Asparaginase/glutaminase family) with a combined E-value of 4.1e-47.
    IPB000267A    2-18
    IPB000267B    34-72
    IPB000267C    77-121
    IPB000267D    126-167
    IPB000267E    298-324


ProDom Summary:  Protein Domain Search
Residues 3-313 are 32% similar to a (L-ASPARAGINASE HYDROLASE L-ASPARAGINE AMIDOHYDROLASE) protein domain (PD003221) which is seen in ASG1_ECOLI.



Paralogs:  Local Blast Search


NG1339 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 322 (E-value = 2.4e-10) place NG1339 in the Asparaginase family which is described as Asparaginase (PF00710)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|3ECA|3ECA-A ASPARAGINASE TYPE II (E.C.3.5.1.1) (ECA) 59.3 9e-10
pdb|1HO3|1HO3-A CRYSTAL STRUCTURE ANALYSIS OF E. COLI 59.3 9e-10
pdb|4ECA|4ECA-A ASPARAGINASE FROM E. COLI, MUTANT T89V WITH 57.4 4e-09
pdb|4PGA|4PGA-A GLUT

Gene Protein Sequence:
MKQKIFVLYTGGTIGMTQSSAGLRPDTALVGQALAPFSDGMDFDWHVCEP
LIDSSAVQLQNWCAWLDIIAAALPQYDGVLVLHGTDTLAYTANMFALALQ
GLDKPIVLTGSQWPYNAEGSDAPRNLVTAVAAFPLGLKQTLIAFDGKLYP
AVGSSKISTETAAGFGNAHFGALAEWDETRGWHNVRIPNQDAADVSDGLE
IRYPDPQAKIAVRTLIPGFAVQELADGLGQLPAQALILQSYGHGNTSAGE
GFIRAVQDFTQQGKLLLNISQVPQGCAAAVYAQGDALRRAGVVNGGKCNL
ETATALMTLAVSEGWGADGVKHELQRLGLV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAGAAAATTTTTGTCCTTTATACCGGCGGCACCATCGGCATGAC
GCAAAGCAGTGCGGGCTTGCGCCCCGATACCGCGCTGGTCGGGCAGGCAC
TCGCGCCGTTTTCAGACGGCATGGATTTCGATTGGCACGTTTGTGAGCCG
CTGATTGATTCTTCCGCCGTCCAACTGCAAAACTGGTGCGCTTGGCTGGA
CATCATTGCCGCCGCGCTGCCGCAGTACGACGGTGTTTTGGTGCTGCACG
GCACGGACACACTCGCCTATACCGCCAATATGTTCGCCCTCGCCCTGCAA
GGTTTGGACAAACCGATCGTCCTGACCGGTTCGCAATGGCCGTACAACGC
AGAGGGCAGCGACGCGCCGCGCAATCTGGTGACTGCCGTTGCCGCATTCC
CACTCGGATTGAAGCAGACGCTTATTGCCTTTGACGGCAAACTGTATCCC
GCCGTCGGCAGCAGCAAAATCAGCACGGAAACCGCCGCCGGTTTCGGCAA
TGCCCATTTCGGCGCACTTGCCGAGTGGGACGAAACCCGGGGCTGGCACA
ATGTCCGCATCCCGAATCAGGACGCGGCAGATGTTTCAGACGGCCTCGAA
ATCCGTTATCCCGACCCGCAGGCAAAAATCGCCGTCCGCACGCTTATCCC
CGGCTTTGCCGTCCAAGAACTTGCCGACGGGCTCGGACAGCTTCCCGCCC
AAGCCCTTATCCTGCAAAGCTACGGACACGGCAATACCTCCGCCGGCGAA
GGCTTCATCCGCGCCGTGCAAGACTTTACGCAGCAAGGCAAATTGTTGCT
TAACATCAGCCAAGTGCCGCAGGGTTGCGCTGCCGCCGTTTACGCACAGG
GCGACGCGCTGCGTCGGGCGGGCGTGGTCAACGGCGGCAAATGCAATTTG
GAAACCGCAACCGCATTGATGACGCTTGCCGTTTCCGAAGGATGGGGCGC
GGACGGGGTGAAACACGAGTTGCAGCGGTTGGGGCTGGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy