Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1093 IGR1088 IGR1090 IGR1087 IGR1089 IGR1092 IGR1091 IGR1094 mutT,nudH, - NG1334 dedA, - NG1340 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 parE, - NG1333 NG1332 serS, - NG1335 mutT,nudH, - NG1334 dedA, - NG1340 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 parE, - NG1333 NG1332 serS, - NG1335 mutT,nudH, - NG1334 dedA, - NG1340 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 mrsA, - NG1341 parE, - NG1333 NG1338 NG1338 NG1332 serS, - NG1335
* Calculated from Protein Sequence

Gene ID: NG1336

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ldhA  ldhD  

Definition:
D-lactate dehydrogenase

Gene Start:
1296540

Gene Stop:
1295545

Gene Length:
996

Molecular Weight*:
36621

pI*:
5.70

Net Charge*:
-6.38

EC:
1.1.1.28  

Functional Class:
Energy metabolism; Fermentation  

Pathway: pathway table
Pyruvate metabolism

Secondary Evidence:
Bunch,P.K., Mat-Jan,F., Lee,N. and Clark,D.P.
The ldhA gene encoding the fermentative lactate dehydrogenase of
Escherichia coli
Microbiology 143 (Pt 1), 187-195 (1997)
Medline: 97177787

Dym,O., Pratt,E.A., Ho,C. and Eisenberg,D.
The crystal structure of D-lactate dehydrogenase, a peripheral
membrane respiratory enzyme
Proc. Natl. Acad. Sci. U.S.A. 97 (17), 9413-9418 (2000)
M:0402548



Comment:
Oklahoma ID: NGO.1336c

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to D-lactate dehydrogenase and related sequences. Residues 1-328 are 75% similar to DDH_HAEIN (gb|AAC21763).

Residues 1-332 are virtually identical to NMA1944 in N.meningitidis (11251634|).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1052
COG name: Lactate dehydrogenase and related dehydrogenases
Functional Class:  C,H,R
The phylogenetic pattern of COG1052 is a--KYq-CEBrHuj---l---
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002162 (D-isomer specific 2-hydroxyacid dehydrogenase) with a combined E-value of 2.5e-66.
    IPB002162A    81-118
    IPB002162B    144-156
    IPB002162C    191-204
    IPB002162D    211-260
    IPB002162E    284-303


ProDom Summary:  Protein Domain Search
Residues 1-77 are 64% similar to a (DEHYDROGENASE OXIDOREDUCTASE NAD 2-HYDROXYACID HOMOLOG) protein domain (PD033442) which is seen in LDHD_ECOLI.

Residues 78-295 are 82% similar to a (NAD DEHYDROGENASE OXIDOREDUCTASE PROTEIN) protein domain (PD000699) which is seen in DDH_HAEIN.



Paralogs:  Local Blast Search


NG1336 is paralogously related to NG2043 (glycerate dehydrogenase fragment) (1e-07).


Pfam Summary:  Pfam Search
Residues 3 to 99 (E-value = 5.6e-21) place NG1336 in the 2-Hacid_dh family which is described as D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain (PF00389)
Residues 105 to 295 (E-value = 7.3e-100) place NG1336 in the 2-Hacid_dh_C family which is described as D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain (PF02826)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|2DLD|2DLD-A D-LACTATE DEHYDROGENASE COMPLEXED WITH NADH AND 198.0 2e-51
pdb|1J49|1J49-A INSIGHTS INTO DOMAIN CLOSURE, SUBSTRATE 190.0 4e-49
pdb|1J4A|1J4A-A INSIGHTS INTO DOMAIN CLOSURE, SUBSTRATE 186.0 4e-48
pdb|1DXY|1DXY STRUC

Gene Protein Sequence:
MKIAIYGTKSYDREHFTRANRHFGFELEFFDFMLDAKTAKMAEGAEAACI
FVNDDASRPVLEKLAQIGVKTVALRCAGFNNVDLKAAEELGLKVVRVPAY
SPESVAEHTVGLMLTLNRRIHKAYQRTRDANFSLEGLTGFNMYGKTAGVI
GTGKIGIATMRILKGFGMNLLAYDPFCNPEVEKLGGRYVDLDELYARSDI
ITLHCPATPENHYMLNEAAFDKMKDGVMIINTSRGGLIDSAAAIEALKCR
KIGALGMDVYENERELFFEDKSNDVITDDVFRRLSSCHNVLFTGHQAFLT
EEALGNISEVTLSNIREVGQTGDCGNAVRADG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATTGCGATTTACGGTACGAAAAGCTATGACCGCGAACATTTTAC
CCGCGCCAACCGGCATTTCGGCTTCGAGCTGGAGTTTTTTGATTTCATGC
TGGATGCGAAAACGGCGAAAATGGCGGAAGGCGCGGAAGCGGCCTGTATT
TTTGTAAACGACGACGCCAGCCGGCCCGTGTTGGAAAAATTGGCGCAAAT
TGGCGTGAAAACTGTGGCGTTGCGTTGTGCCGGCTTCAATAATGTGGATT
TGAAGGCGGCTGAAGAGTTGGGCTTGAAAGTCGTGCGCGTGCCTGCCTAT
TCGCCCGAATCGGTTGCGGAACATACGGTCGGTCTGATGCTGACTTTGAA
CCGCCGTATCCACAAAGCCTACCAGCGTACCCGCGATGCGAATTTTTCGC
TGGAAGGTCTGACCGGCTTCAATATGTACGGCAAAACGGCGGGCGTTATC
GGCACGGGGAAAATCGGTATCGCAACGATGCGGATTTTAAAGGGTTTCGG
TATGAACCTGCTGGCTTACGATCCGTTTTGCAACCCCGAAGTGGAAAAAC
TCGGCGGCAGGTATGTGGATTTGGACGAGCTGTATGCCCGATCGGACATC
ATCACGCTGCATTGTCCCGCCACGCCGGAAAACCACTATATGCTGAACGA
AGCGGCGTTCGACAAAATGAAAGACGGCGTGATGATTATCAACACCAGCC
GGGGCGGGCTGATTGACAGCGCCGCCGCCATCGAGGCGTTGAAATGCCGG
AAAATCGGTGCATTGGGCATGGATGTGTACGAGAACGAGCGCGAGCTGTT
TTTTGAAGACAAATCCAACGATGTGATTACCGACGACGTGTTCCGCCGCC
TGTCGTCTTGTCATAACGTACTGTTTACCGGACATCAGGCATTTTTGACG
GAAGAGGCGTTGGGTAATATTTCGGAAGTTACGCTGTCCAATATCCGCGA
GGTCGGACAGACCGGCGATTGCGGCAATGCGGTTCGTGCCGACGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy