Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1093 IGR1088 IGR1090 IGR1087 IGR1089 IGR1092 IGR1086 IGR1091 mutT,nudH, - NG1334 dedA, - NG1340 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 dedA, - NG1340 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 dedA, - NG1340 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 parE, - NG1333 NG1338 NG1338 NG1332 aroC, - NG1331 serS, - NG1335
* Calculated from Protein Sequence

Gene ID: NG1335

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
serS  

Definition:
seryl-tRNA synthetase

Gene Start:
1294174

Gene Stop:
1295466

Gene Length:
1293

Molecular Weight*:
47817

pI*:
5.90

Net Charge*:
-8.78

EC:
6.1.1.11  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glycine, serine and threonine metabolism

Comment:
Oklahoma ID: NGO.1335

For other 'ser' genes, see NG1283 (serC) and NG1468 (serB).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to seryl-tRNA synthetases. Residues 1-429 are 68% similar to the enzyme in Burkholderia cepacia (AJ293306).

Residues 1-431 are virtually identical to NMA1943 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0172
COG name: Seryl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0172 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003364 (Seryl-tRNA synthetase N-terminal domain) with a combined E-value of 1e-158.
    IPB003364A    1-10
    IPB003364B    105-129
    IPB003364C    140-177
    IPB003364D    190-221
    IPB003364E    230-257
    IPB003364F    266-291
    IPB003364G    337-374
    IPB003364H    383-410
    IPB003364I    414-423


ProDom Summary:  Protein Domain Search
Residues 1-98 are 51% similar to a (SYNTHETASE SERYL-TRNA AMINOACYL-TRNA) protein domain (PD003933) which is seen in SYS_ECOLI.

Residues 387-422 are 83% similar to a (SYNTHETASE SERYL-TRNA AMINOACYL-TRNA) protein domain (PD002919) which is seen in SYS_HAEIN.

Residues 135-386 are 69% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD000380) which is seen in SYS_ECOLI.



Paralogs:  Local Blast Search


NG1335 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 109 (E-value = 1.6e-44) place NG1335 in the Seryl_tRNA_N family which is described as Seryl-tRNA synthetase N-terminal domain (PF02403)
Residues 162 to 323 (E-value = 2.3e-54) place NG1335 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
23  
104

PDB Hit:
pdb|1SER|1SER-A SERYL-TRNA SYNTHETASE (E.C.6.1.1.11) COMPLEXED 257.0 2e-69

Gene Protein Sequence:
MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQAS
RNSISKQIGALKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDA
WLLSIPNLPHESVPPGKDETENVEVRKVGTPREFDFEIKDHVDLGEPLGL
DFEGGAKLSGARFTVMRGQIARLHRALAQFMLDTHMLQHGYTEHYTPYIV
DDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAEVTLTNTVAGSI
IPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPEK
SYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQ
NTYREISSCSNCEDFQARRMKARFKDENGKNRLVHTLNGSGLAVGRTLVA
VLENHQNADGSINIPAALQPYMGGVTKLEVK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGATATCCAATTGCTCCGCAGCAACACCGCCGCCGTTGCCGAACG
GCTTGCACGGCGCGGTTATGACTTTGATACCGCACGTTTTGACGCACTGG
AAGAACGACGCAAGTCCGTTCAGGTGAAAACCGAAGAACTACAAGCCTCG
CGCAACAGCATTTCCAAACAAATCGGCGCACTGAAAGGTCAGGGCAAACA
TGAAGAGGCGCAGGCGGCCATGGATCAAGTCGCCCAAATCAAAACCGATT
TGGAACAGGCTGCCGCCGATTTGGATGCCGTTCAAAAAGAATTGGACGCA
TGGTTGTTGAGCATACCTAACCTGCCGCACGAAAGCGTACCTCCCGGTAA
AGACGAAACCGAAAACGTCGAAGTCCGCAAAGTCGGTACGCCGCGCGAAT
TTGATTTTGAAATCAAAGATCATGTCGATTTGGGCGAGCCTTTGGGCTTG
GATTTCGAAGGCGGCGCGAAACTTTCCGGCGCACGATTTACCGTGATGCG
CGGACAAATCGCCCGTCTGCACCGCGCCTTGGCGCAATTCATGCTCGATA
CGCACATGCTGCAACACGGCTACACCGAGCATTACACGCCTTATATCGTT
GACGATACGACGCTGCAAGGCACAGGTCAGCTGCCCAAATTTGCAGAAGA
TTTGTTCCACGTTACCCGCGGCGGCGATGAAACCAAAACCACGCAATATC
TGATTCCGACAGCCGAAGTTACCCTGACCAATACCGTTGCCGGCAGCATT
ATCCCGTCCGAACAACTGCCGCTGAAGCTGACCGCGCATTCGCCCTGTTT
CCGCAGTGAAGCGGGATCATACGGCAAAGACACGCGCGGCCTAATCCGCC
AGCACCAGTTCGACAAAGTAGAAATGGTACAAATCGTTCATCCCGAAAAA
TCATACGGCGCGCTGGAAGAAATGGTCGGCCATGCCGAAAACATCCTGAA
GGCTTTGGAACTGCCCTACCGCGTGATTACCCTGTGTACCGGCGACATGG
GTTTCAGCGCGGCCAAAACGTATGACTTGGAAGTTTGGGTTCCCGCACAA
AATACCTACCGCGAAATCTCAAGCTGCTCCAACTGCGAAGATTTCCAAGC
ACGCCGCATGAAGGCGCGTTTCAAAGACGAAAACGGCAAAAACCGCTTGG
TACATACCTTAAACGGCTCCGGTTTGGCAGTCGGTCGCACTTTGGTCGCG
GTTTTGGAAAACCATCAAAACGCCGACGGCAGCATCAATATCCCCGCCGC
ACTGCAACCGTATATGGGCGGTGTTACCAAGTTGGAAGTGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy