Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1088 IGR1090 IGR1087 IGR1089 IGR1092 IGR1086 IGR1091 IGR1085 mutT,nudH, - NG1334 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 trmA, - NG1330 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 ansA, - NG1339 ldhA,ldhD, - NG1336 prfA, - NG1337 trmA, - NG1330 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 ldhA,ldhD, - NG1336 prfA, - NG1337 trmA, - NG1330 parE, - NG1333 NG1338 ansA, - NG1339 NG1338 NG1332 aroC, - NG1331 serS, - NG1335
* Calculated from Protein Sequence

Gene ID: NG1334

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mutT  nudH  

Definition:
MutT-like protein; invasion protein

Gene Start:
1294092

Gene Stop:
1293487

Gene Length:
606

Molecular Weight*:
24207

pI*:
9.30

Net Charge*:
4.83

EC:
3.6.1.-  

Functional Class:
Unassigned  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
For other 'mut'genes see NG0710(mutY),NG0744(mutL),NG1930 (mutS), NG1506 (mutT).

Oklahoma ID: NGO.1334c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to MutT/nudix family proteins/invasion proteins. Residues 29-181 are 53% similar to NUDH_ECOLI (gb|AAB40477).

Residues 29-202 are virtually identical to NMA1942 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0494
COG name: NTP pyrophosphohydrolases (MutT family) including oxidative damage repair enzymes
Functional Class:  L,R
The phylogenetic pattern of COG0494 is a-T-YqvCEBRHuj---linx
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
***** IPB000086 (NUDIX hydrolase) with a combined E-value of 1.5e-11.
    IPB000086    61-87


ProDom Summary:  Protein Domain Search
Residues 122-181 are 53% similar to a (PROTEIN INVASION HYDROLASE A) protein domain (PD012460) which is seen in YGDP_ECOLI.

Residues 35-108 are 62% similar to a (PROTEIN HYDROLASE MUTT MUTATOR) protein domain (PD000653) which is seen in YGDP_ECOLI.



Paralogs:  Local Blast Search


NG1334 is paralogously related to NG0224 (nucleoside triphosphate pyrophosphohydrolase (Na(+)-translocating ATPase)) (7e-05).


Pfam Summary:  Pfam Search
Residues 35 to 179 (E-value = 1.6e-23) place NG1334 in the NUDIX family which is described as NUDIX domain (PF00293)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1F3Y|1F3Y-A SOLUTION STRUCTURE OF THE NUDIX ENZYME 107.0 2e-24
pdb|1MUT|1MUT NMR STUDY OF MUTT ENZYME, A NUCLEOSIDE 58.9 7e-10
pdb|1F3Y|1F3Y-A SOLUTION STRUCTURE OF THE NUDIX ENZYME 231.0 1e-61
pdb|1MUT|1MUT NMR S

Gene Protein Sequence:
MLEPYRPICQNRPICGKIPRLNLTEGDTVLDREGYRPNVGIILINERNEV
FWGKRVREHSWQFPQGGIKPGESPETAMYRELYEEVGLLPQHVKIVGRTR
DWLRYDVPNNWVRREWRGSYRGQKQIWYLLRLTGRDCDVNLRATRHPEFD
GWRWHQYWAPVDEVIDFKRDVYLEALKELSSRFLRGMESYEDFAARQPSG
NR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTGAACCATACCGTCCGATTTGTCAAAACCGTCCGATTTGTGGGAA
AATCCCAAGATTGAATTTAACGGAGGGCGACACCGTGTTGGACAGGGAAG
GCTATCGCCCCAATGTCGGTATTATCCTAATTAACGAACGTAACGAAGTC
TTTTGGGGTAAGCGCGTGCGCGAACATTCATGGCAGTTTCCTCAAGGCGG
CATCAAGCCCGGCGAAAGCCCCGAAACCGCGATGTACCGCGAACTTTACG
AAGAAGTCGGACTTCTGCCGCAACACGTCAAAATCGTCGGGCGGACGCGC
GACTGGCTGCGTTACGACGTGCCGAACAACTGGGTGCGCCGCGAATGGCG
CGGCTCTTATCGCGGACAGAAGCAGATTTGGTATCTCCTGCGCCTGACCG
GCCGGGATTGCGATGTCAACCTGCGCGCCACCCGCCACCCCGAATTTGAC
GGCTGGCGTTGGCATCAATATTGGGCGCCCGTTGACGAAGTGATTGATTT
CAAACGCGACGTTTATTTGGAGGCGTTGAAAGAACTCTCTTCCCGCTTCC
TGCGCGGTATGGAAAGTTATGAAGACTTTGCCGCCCGCCAACCTTCCGGC
AACCGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy