Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1084 IGR1088 IGR1090 IGR1087 IGR1089 IGR1086 IGR1091 IGR1085 mutT,nudH, - NG1334 ldhA,ldhD, - NG1336 prfA, - NG1337 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 ldhA,ldhD, - NG1336 prfA, - NG1337 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 ldhA,ldhD, - NG1336 prfA, - NG1337 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1332 aroC, - NG1331 serS, - NG1335
* Calculated from Protein Sequence

Gene ID: NG1333

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parE  

Definition:
DNA topoisomerase IV subunit B

Gene Start:
1293417

Gene Stop:
1291435

Gene Length:
1983

Molecular Weight*:
72090

pI*:
5.90

Net Charge*:
-12.59

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Breines,D.M., Ouabdesselam,S., Ng,E.Y., Tankovic,J., Shah,S.,
Soussy,C.J. and Hooper,D.C.
Quinolone resistance locus nfxD of Escherichia coli is a mutant
allele of the parE gene encoding a subunit of topoisomerase IV
Antimicrob. Agents Chemother. 41 (1), 175-179 (1997)
Medline: 97135236

Peng,H. and Marians,K.J.
Escherichia coli topoisomerase IV. Purification, characterization,
subunit structure, and subunit interactions
J. Biol. Chem. 268 (32), 24481-24490 (1993)
Medline: 94043292

Kato,J., Nishimura,Y., Imamura,R., Niki,H., Hiraga,S. and Suzuki,H.
New topoisomerase essential for chromosome segregation in E. coli
Cell 63 (2), 393-404 (1990)
Medline: 91004247


Comment:
For other 'par' genes see NG1259 (parC), NG1790 (parA), NG2141 (parB).

Oklahoma ID: NGO.1333c

For the A subunit, see NG1259.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to DNA topoisimerase IV subunit B sequences. Residues 7-661 are 50% similar to PARE_HAEIN (gb|AAC23174).

Residues 1-661 are virtually identical to NMA1941 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001241 (DNA topoisomerase II family) with a combined E-value of 1.5e-109.
    IPB001241A    12-33
    IPB001241B    111-129
    IPB001241C    168-180
    IPB001241D    283-296
    IPB001241E    328-354
    IPB001241F    430-478
    IPB001241G    501-527
    IPB001241H    592-615


ProDom Summary:  Protein Domain Search
Residues 378-481 are 61% similar to a (TOPOISOMERASE ISOMERASE ATP-BINDING DNA SUBUNIT B GYRASE) protein domain (PD000714) which is seen in PARE_HAEIN.

Residues 494-579 are 60% similar to a (TOPOISOMERASE ISOMERASE ATP-BINDING DNA SUBUNIT B GYRASE) protein domain (PD000616) which is seen in PARE_HAEIN.

Residues 145-375 are 41% similar to a (TOPOISOMERASE SUBUNIT ISOMERASE ATP-BINDING B DNA GYRASE) protein domain (PD001260) which is seen in PARE_ECOLI.

Residues 590-639 are 60% similar to a (TOPOISOMERASE SUBUNIT ISOMERASE) protein domain (PD149633) which is seen in GYRB_NEIGO.

Residues 7-129 are 63% similar to a (TOPOISOMERASE ISOMERASE ATP-BINDING DNA SUBUNIT B GYRASE) protein domain (PD000740) which is seen in PARE_HAEIN.



Paralogs:  Local Blast Search


NG1333 is paralogously related to NG1772 (DNA gyrase chain B / DNA topoisomerase (ATP-hydrolyzing)) (2e-96).


Pfam Summary:  Pfam Search
Residues 29 to 178 (E-value = 3.7e-22) place NG1333 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 228 to 405 (E-value = 2.8e-30) place NG1333 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 582 to 651 (E-value = 1.5e-23) place NG1333 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1KIJ|1KIJ-A CRYSTAL STRUCTURE OF THE 43K ATPASE DOMAIN OF 240.0 5e-64
pdb|1EI1|1EI1-A DIMERIZATION OF E. COLI DNA GYRASE B PROVIDES A 226.0 1e-59
pdb|1AJ6|1AJ6 NOVOBIOCIN-RESISTANT MUTANT (R136H) OF THE 181.0 3e-46
pdb|1KZN|1KZN-A CRYS

Gene Protein Sequence:
MAKNNQYSESSITVLKGLEPVKERPGMYTRTDSPTHICQEVIDNAADEAL
GGFATEIDVQIHEDGSLSVRDNGRGIPVGLHPEEGVPVVELVFTRLHAGG
KFNKKDGGSAYAFSGGLHGVGVSVTNALSTRLEVSVKRDGKVHRIVFAGG
DVVEPLAQVGKCAVKDSGTEVRVWPDGKYFESPNYSIPELERLLRAKAVL
LPGVRVSLTRPVKGEDEAHTQTWHYPDGLKSYLTDLIADAQEAVPLFSCE
NYISDGHNGDFSIGEGAAFALTWLEEGSCANESYVNLIPTSLGGTHEAGL
KQAVFNAVNNFINLHNLLPRGVKVQSDDVFGKTAFVLSARVLDPQFQGQT
KDKLTNRDALKLVAAVSGDPLELWLNQNVDFGKKIAELAIRQAQARIRSV
KKIEKKKGSGVAILPGKLTDCESEDIRENELFLVEGDSAGGSAKLARDKA
TQAILPLRGKVLNSFEVHPDQLFGNAEIHDISVAVGVDPHAINDHPDLSG
LRYGKIAILSDADVDGSHIQVLLLTLFYRHFPKLVADGHIYVAQPPLFRV
DVNAQGKSKPARKFYALDQNELDGILERLQKEGVKETAYSISRFKGLGEM
NPDQLKDTTMHPDTRRLLQVQIPEGADDETRDIFVKLMGKGEAAARRAWM
EREGDTAQLDI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAAACAACCAATACAGCGAATCCAGCATCACCGTCCTCAAAGG
CTTGGAGCCGGTCAAAGAACGTCCCGGCATGTACACCCGCACCGACAGCC
CGACACATATCTGCCAAGAAGTCATCGACAACGCGGCGGACGAGGCGTTG
GGCGGTTTCGCCACTGAAATCGACGTGCAAATTCATGAAGACGGTTCGCT
TTCCGTGCGCGACAACGGGCGCGGCATTCCCGTCGGCCTGCACCCTGAAG
AAGGCGTACCCGTAGTCGAACTCGTGTTTACCCGCCTGCACGCGGGCGGC
AAGTTCAACAAAAAAGACGGCGGCAGTGCGTATGCCTTTTCAGGCGGCCT
GCACGGTGTGGGCGTATCCGTTACCAATGCGCTTTCCACCCGACTTGAAG
TCAGTGTCAAACGAGACGGCAAAGTCCACCGCATCGTGTTTGCCGGCGGC
GATGTGGTCGAACCGTTGGCACAAGTGGGCAAATGCGCCGTCAAAGACAG
CGGCACCGAAGTGCGCGTGTGGCCGGACGGCAAATATTTTGAAAGCCCGA
ATTACAGCATTCCCGAACTCGAGCGTCTATTGCGCGCCAAAGCCGTGCTG
CTGCCGGGCGTGCGCGTTTCCCTGACCCGTCCGGTCAAAGGCGAAGACGA
AGCGCACACCCAAACCTGGCATTACCCCGACGGTCTGAAAAGCTATCTGA
CCGACCTGATTGCCGACGCACAGGAAGCCGTGCCGCTGTTCTCCTGCGAA
AACTACATTTCAGACGGCCACAACGGCGATTTCAGCATTGGCGAAGGTGC
CGCGTTTGCTTTGACTTGGCTGGAAGAAGGCTCGTGCGCCAACGAAAGCT
ACGTCAACCTTATCCCGACCTCGCTGGGCGGAACGCACGAAGCAGGCTTG
AAACAAGCCGTGTTCAACGCCGTCAACAATTTCATCAACCTGCACAACCT
CTTACCGCGCGGCGTTAAAGTGCAAAGCGACGACGTGTTCGGAAAAACCG
CCTTCGTCCTCTCCGCCCGCGTCCTCGACCCGCAATTCCAAGGTCAGACC
AAAGACAAGCTGACCAACCGCGACGCGCTGAAACTTGTCGCCGCCGTATC
GGGCGATCCTTTGGAATTGTGGCTGAACCAAAACGTGGACTTCGGCAAAA
AAATCGCCGAACTCGCCATCCGTCAGGCACAGGCACGGATACGTTCGGTT
AAAAAAATCGAAAAGAAAAAAGGCAGCGGCGTCGCCATCCTGCCCGGTAA
GCTGACCGACTGTGAAAGCGAAGACATCCGCGAAAACGAACTCTTCCTCG
TCGAAGGCGATTCCGCCGGCGGCTCCGCCAAACTCGCCCGCGACAAAGCC
ACACAAGCCATCCTGCCCCTGCGCGGCAAAGTGCTCAATAGCTTTGAAGT
CCACCCCGACCAGCTTTTCGGCAACGCCGAAATCCACGACATTTCCGTCG
CCGTCGGTGTCGATCCGCACGCCATCAACGACCATCCCGACTTAAGCGGC
CTGCGCTACGGCAAAATAGCCATCTTGTCCGATGCCGACGTGGACGGTTC
GCATATTCAGGTTTTGCTGTTGACCCTGTTCTACCGCCACTTCCCCAAAC
TGGTCGCCGACGGACACATCTACGTCGCCCAGCCGCCGCTGTTCCGCGTC
GATGTCAACGCACAAGGCAAAAGCAAACCCGCCCGCAAATTCTACGCCCT
CGACCAAAACGAACTTGACGGCATTTTAGAGCGGCTGCAAAAAGAAGGCG
TTAAAGAAACCGCCTATTCCATCAGCCGTTTCAAAGGCTTGGGCGAGATG
AACCCCGACCAGCTCAAAGACACCACCATGCACCCCGACACCCGCCGCCT
GTTGCAGGTGCAAATCCCCGAAGGCGCGGATGACGAGACGCGCGACATCT
TCGTCAAACTGATGGGCAAAGGCGAAGCCGCCGCCCGCCGCGCTTGGATG
GAACGCGAAGGCGATACGGCGCAACTCGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy