Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR1084 IGR1088 IGR1087 IGR1089 IGR1082 IGR1086 IGR1085 IGR1083 IGR1081 mutT,nudH, - NG1334 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 serS, - NG1335 mutT,nudH, - NG1334 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 serS, - NG1335 Type: direct, Name:  - 132 Type: direct, Name:  - 134 mutT,nudH, - NG1334 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 serS, - NG1335
* Calculated from Protein Sequence

Gene ID: NG1331

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroC  

Definition:
chorismate synthase

Gene Start:
1289742

Gene Stop:
1290839

Gene Length:
1098

Molecular Weight*:
39321

pI*:
6.70

Net Charge*:
-2.04

EC:
4.6.1.4  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Charles,I.G., Lamb,H.K., Pickard,D., Dougan,G. and Hawkins,A.R.
Isolation, characterization and nucleotide sequences of the aroC
genes encoding chorismate synthase from Salmonella typhi and
Escherichia coli.
J. Gen. Microbiol. 136 (Pt 2), 353-358 (1990)
Medline: 90218018


Comment:
For other 'aro' genes,see NG0092 (aroB), NG0740 (aroD), NG0093
(aroK), NG900(aroA), NG1602 (aroE),NG1695 (aroG).

Oklahoma ID: NGO.1331

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to chorismate synthase sequences. Residues 1-361 are 62% similar to AROC_VIBAN (gb|AAA21830).

Residues 1-366 are virtually identical to NMB1680 in N.meningitidis (gb|AAF42028).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0082
COG name: Chorismate synthase
Functional Class:  E
The phylogenetic pattern of COG0082 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000453 (Chorismate synthase) with a combined E-value of 1.2e-148.
    IPB000453A    10-51
    IPB000453B    57-81
    IPB000453C    103-131
    IPB000453D    225-261
    IPB000453E    270-298
    IPB000453F    318-342


ProDom Summary:  Protein Domain Search
Residues 1-351 are 63% similar to a (CHORISMATE SYNTHASE PHOSPHOLYASE LYASE) protein domain (PD002941) which is seen in AROC_VIBAN.



Paralogs:  Local Blast Search


NG1331 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 348 (E-value = 2.4e-206) place NG1331 in the Chorismate_synt family which is described as Chorismate synthase (PF01264)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
329  
345

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAGNTFGQIFTVTTFGESHGAGLGCIIDGCPPGLELSEADIQFDLDRRKP
GTSRHVTQRREADQVEILSGVFEGKTTGTPIALLIRNTDQRSKDYGNIAT
AFRPGHADYTYWHKYGTRDYRGGGRSSARETAARVAAGAVAKKWLKEKFG
TEITAYVTQVGEKKIRFEGSEHISQNPFFAANQSQIAELEHYMDGVRKSL
DSVGAKLHIEAANVPVGLGEPVFDRLDAEIAYAMMGINAVKGVEIGAGFD
SVTQRGSEHGDELTPQGFLSNHSGGILGGISTGQDICVNIAIKPTSSIAT
PRRSIDIHGNPVELATRGRHDPCVGLRTAPIAEAMLALVLIDHALRHRAQ
NADVAADTPDISRSDK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGGCAACACTTTCGGACAAATCTTCACCGTGACCACCTTCGGCGA
AAGCCACGGCGCGGGTTTGGGCTGCATCATCGACGGCTGCCCGCCCGGCT
TGGAATTAAGCGAAGCGGATATCCAATTTGACCTCGACCGGCGCAAACCC
GGCACCAGCCGCCACGTTACCCAACGCCGCGAAGCCGACCAAGTCGAAAT
CCTCTCCGGCGTATTCGAAGGCAAAACCACCGGCACACCCATCGCCCTCC
TAATCCGCAACACCGACCAGCGCAGCAAAGACTACGGCAACATCGCCACC
GCCTTCCGCCCCGGACACGCCGACTATACCTATTGGCACAAATACGGTAC
GCGCGACTACCGGGGCGGCGGCAGGAGTTCCGCCCGCGAAACCGCAGCCC
GCGTTGCCGCCGGAGCCGTTGCCAAAAAATGGCTGAAAGAAAAATTCGGC
ACGGAAATCACCGCCTACGTTACCCAAGTCGGCGAAAAAAAAATCCGGTT
TGAAGGCAGCGAACACATTTCCCAAAATCCTTTTTTTGCCGCCAACCAAA
GCCAAATCGCCGAACTGGAACACTATATGGACGGTGTGCGCAAATCCTTG
GATTCCGTCGGCGCGAAACTGCATATCGAAGCCGCCAACGTCCCCGTCGG
TTTGGGCGAACCCGTTTTCGACCGCCTCGATGCCGAAATCGCCTACGCGA
TGATGGGCATCAACGCCGTCAAAGGCGTGGAAATCGGCGCAGGTTTTGAC
AGCGTAACGCAACGCGGCAGCGAACACGGCGACGAACTGACCCCGCAAGG
CTTCCTGTCCAACCATTCGGGCGGCATCCTCGGCGGCATCAGCACCGGGC
AAGACATCTGCGTCAATATCGCCATCAAACCCACCAGCTCCATCGCCACA
CCGCGCCGAAGCATCGACATTCACGGCAACCCCGTCGAACTCGCCACCCG
CGGCAGGCACGATCCCTGCGTCGGCTTGCGCACCGCGCCGATTGCCGAAG
CTATGCTCGCCTTGGTTTTAATCGACCACGCCCTGCGCCATCGTGCGCAA
AATGCGGATGTTGCCGCGGATACGCCCGATATTTCCCGCTCGGACAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy