Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR1084 IGR1088 IGR1087 IGR1082 IGR1086 IGR1080 IGR1085 IGR1083 IGR1081 NG1326 mutT,nudH, - NG1334 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 gcvP,gcvHP, - NG1325 NG1326 mutT,nudH, - NG1334 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 gcvP,gcvHP, - NG1325 Type: direct, Name:  - 132 Type: direct, Name:  - 134 NG1326 mutT,nudH, - NG1334 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 gcvP,gcvHP, - NG1325
* Calculated from Protein Sequence

Gene ID: NG1330

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmA  

Definition:
tRNA (uracil-5-)-methyltransferase

Gene Start:
1289595

Gene Stop:
1288510

Gene Length:
1086

Molecular Weight*:
41294

pI*:
5.70

Net Charge*:
-6.33

EC:
2.1.1.35  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Primary Evidence:
Sarandopoulos,S. and Davies,J.K.
Lack of substantial sequence homology between the cryptic plasmid
and chromosome of Neisseria gonorrhoeae.
Plasmid 29 (1), 41-49 (1993)
M:93181472


Secondary Evidence:
Gustafsson,C., Lindstroem,P.H.R., Hagervall,T.G., Esberg,K.B. and
Bjoerk,G.R.
The trmA promoter has regulatory features and sequence elements in
common with the rRNA P1 promoter family of Escherichia coli. J. Bacteriol. 173, 1757-1764 (1991)
M:91154132


Comment:
Oklahoma ID: NGO.1330c

For other 'trm' genes, see NG0819 (trmH), NG1214 (trmU), NG0172 (trmD).

Blast Summary:  PSI-Blast Search
NG1330 is 97% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1717750, a predicted tRNA (uracil-5-)-methyltransferase. Residues 69-293 align with residues 1-225 of 1717750, suggesting a start codon discrepancy.

Residues 1-362 are virtually identical to NMB1679 in N.meningitidis ( gb|AAF42027).

COGS Summary:  COGS Search
BeTs to 9 clades of COG2265
COG name: SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase
Functional Class:  J
The phylogenetic pattern of COG2265 is ----Y---E--h------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001566 (RNA methyltransferase trmA family) with a combined E-value of 7.9e-46.
    IPB001566A    206-247
    IPB001566B    290-300
    IPB001566C    313-322
    IPB001566D    334-357


ProDom Summary:  Protein Domain Search
Residues 296-357 are 64% similar to a (PROTEIN METHYLTRANSFERASE TRANSFERASE RRNA RNA) protein domain (PD004091) which is seen in TRMA_ECOLI.

Residues 4-295 are 46% similar to a (TRNA URACIL-5--METHYLTRANSFERASE) protein domain (PD033737) which is seen in TRMA_ECOLI.



Paralogs:  Local Blast Search


NG1330 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 360 (E-value = 2.2e-262) place NG1330 in the tRNA_U5-meth_tr family which is described as tRNA (Uracil-5-)-methyltransferase (PF05958)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNDYTQQLQGKKDYLKTLFAGLDVPEWEVYESPDKHYRMRAEFRIWHEGG
EMFYAMFEKGQKASGASLIRCDRFDAASEAVNCLMPELIAVAAQSAELRN
HWYAVEFLSTLSGEMLVTMIYHKRLDDEWMKAAQALQQQLDISVIGRSRG
QKIVLKQDYVTETLRVGDRDFHYRQIEGSFTQPNAAVCRKMLEWACRAAE
GLGGDLLELYCGNGNFTLPLSRYFRQVLATEISKTSVSAAQWNIEANWIG
NIKIARLSAEEFTEAYTGKREFTRLKESGIVLTDYAFSTIFVDPPRAGID
EETLKLVSQFDNIIYISCNPETLRANLDTLTETHTVGRAALFDQFPFTHH
IESGVLLKKKIL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGACTACACGCAGCAGCTTCAAGGTAAAAAAGACTACCTTAAAAC
CCTTTTTGCAGGTTTGGATGTTCCTGAGTGGGAAGTGTACGAATCTCCGG
ACAAACACTACCGCATGCGCGCCGAATTCCGCATTTGGCACGAAGGCGGT
GAAATGTTTTACGCCATGTTTGAAAAAGGGCAGAAGGCTAGCGGGGCAAG
CCTGATCCGTTGCGACCGTTTCGATGCTGCTTCAGAGGCAGTCAACTGCC
TGATGCCCGAATTGATTGCCGTTGCCGCCCAATCTGCCGAACTGAGAAAC
CATTGGTATGCCGTCGAATTTCTGTCCACGCTCAGCGGGGAAATGCTGGT
TACCATGATTTACCACAAAAGGCTTGATGATGAGTGGATGAAGGCGGCGC
AAGCGTTACAGCAACAGTTGGATATTTCCGTTATCGGGCGGAGCAGGGGG
CAGAAAATAGTCTTAAAACAGGACTATGTGACGGAAACCCTGCGCGTCGG
CGACCGCGATTTCCACTACCGCCAAATCGAAGGCAGCTTTACCCAGCCGA
ATGCCGCTGTATGCCGGAAAATGCTCGAATGGGCGTGCCGCGCGGCGGAA
GGCTTGGGCGGCGACCTGCTCGAACTGTATTGCGGCAACGGCAATTTCAC
CCTGCCGCTGTCCCGATATTTCCGACAGGTTTTGGCAACCGAAATCTCCA
AAACCTCCGTCAGTGCGGCGCAATGGAATATTGAGGCAAACTGGATAGGC
AACATCAAAATCGCCCGCCTGTCTGCTGAGGAGTTTACCGAAGCCTATAC
CGGAAAACGTGAGTTTACACGCCTTAAGGAGAGCGGTATTGTTTTGACGG
ATTACGCATTTTCCACTATTTTCGTCGATCCGCCGCGTGCCGGCATCGAT
GAGGAAACTTTGAAGCTGGTGTCGCAGTTCGACAACATCATCTACATTTC
CTGCAATCCCGAAACGCTGCGCGCCAATTTGGACACCTTGACGGAAACCC
ATACGGTCGGACGTGCCGCCCTGTTCGACCAATTCCCGTTTACGCACCAT
ATCGAAAGCGGCGTACTGTTGAAAAAGAAAATCCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy