Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR1084 IGR1087 IGR1082 IGR1086 IGR1080 IGR1085 IGR1083 IGR1081 NG1326 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 gcvP,gcvHP, - NG1325 NG1326 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 gcvP,gcvHP, - NG1325 Type: direct, Name:  - 132 Type: direct, Name:  - 134 NG1326 cycB, - NG1328 trmA, - NG1330 tyrB, - NG1329 parE, - NG1333 NG1327 NG1332 aroC, - NG1331 gcvP,gcvHP, - NG1325
* Calculated from Protein Sequence

Gene ID: NG1329

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrB  

Definition:
amino acid aminotransferase

Gene Start:
1288487

Gene Stop:
1287297

Gene Length:
1191

Molecular Weight*:
44494

pI*:
6.00

Net Charge*:
-4.48

EC:
2.6.1.1  2.6.1.57  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table
Alanine and aspartate metabolism
Alkaloid biosynthesis I
Arginine and proline metabolism
Carbon fixation
Cysteine metabolism
Glutamate metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Tyrosine metabolism

Secondary Evidence:
Kuramitsu,S., Inoue,K., Ogawa,T., Ogawa,H. and Kagamiyama,H.
Aromatic amino acid aminotransferase of Escherichia coli nucleotide sequence of the tyrB gene.
Biochem. Biophys. Res. Commun. 133, 134-139 (1985)
M:86076977

Kuramitsu,S., Okuno,S., Ogawa,T., Ogawa,H. and Kagamiyama,H. Aspartate aminotransferase of Escherichia coli:
nucleotide sequence of the aspC gene
J. Biochem. 97 (4), 1259-1262 (1985)
MEDLINE: 85289110

Fotheringham,I.G., Dacey,S.A., Taylor,P.P., Smith,T.J., Hunter,M.G., Finlay,M.E., Primrose,S.B., Parker,D.M.
and Edwards,R.M.
The cloning and sequence analysis of the aspC and tyrB genes from Escherichia coli K12.
Comparison of the primary structures of the aspartate aminotransferase and aromatic aminotransferase of E. coli
with those of the pig aspartate aminotransferase isoenzymes Biochem. J. 234 (3), 593-604 (1986)
MEDLINE: 86242111


Comment:
Oklahoma ID: NGO.1329c

For other 'tyr' genes see NG0066 (tyrS) and NG1515 (tyrC).


For other aminotransferases, see NG0082 (avtA), NG0308 (bioA), NG0460, NG0646 (argD), NG1047 (aat), NG1241 (hisC), NG1283 (serC), NG2045 (glmS), NG1452 (aspC).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to aromatic-amino-acid aminotransferase sequences. Residues 1-396 are 57% similar to the tyrosine aminotransferase in Escherichia coli O157:H7 (gb|AAG59252).

Residues 1-397 are 91% similar to NMB1678 in N.meningitidis (gb|AAF42026).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1448
COG name: Aspartate/aromatic aminotransferase
Functional Class:  E
The phylogenetic pattern of COG1448 is ----Y---E--h------in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001511 (Aminotransferases class-I) with a combined E-value of 5.2e-17.
    IPB001511A    65-75
    IPB001511B    176-190
    IPB001511C    243-256


ProDom Summary:  Protein Domain Search
Residues 131-395 are 53% similar to a (AMINOTRANSFERASE TRANSFERASE TRANSAMINASE ASPARTATE) protein domain (PD000504) which is seen in O85746_KLEPN.



Paralogs:  Local Blast Search


NG1329 is paralogously related to NG1452 (aspartate aminotransferase) (4e-90).


Pfam Summary:  Pfam Search
Residues 80 to 396 (E-value = 4.5e-81) place NG1329 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|3TAT|3TAT-A TYROSINE AMINOTRANSFERASE FROM E. COLI 473.0 0e+00
pdb|1AHE|1AHE-A ASPARTATE AMINOTRANSFERASE HEXAMUTANT 330.0 3e-91
pdb|1AAW|1AAW ASPARTATE AMINOTRANSFERASE (E.C.2.6.1.1) WILD 325.0 1e-89
pdb|1IX6|1IX6-A ASPA

Gene Protein Sequence:
MYRHIEYYPGDPILSLVETFKNDPRPEKVNLSIGIYFDDEGRMPVLESVS
RAETARAAAPAPSPYLPMEGLDVYRSAVQHLLFGKGNPALAQGRIVTVQT
LGGSGALKVGADFLHRWFPEARAYVSDPTWDNHRGIFEGAGFEVGTYPYY
DPATVGVKFDEMTAFFNTLPENSVLILHPCCHNPTGVDMSERQWDEVLQI
IKTRKLIPFMDIAYQGFGGDLDSDAYAVRKAVEMDLPLFVSNSFSKNLSL
YGERVGGLSVVCPNKEEADLVFGQLKFTVRRIYSSPPAHGAYIAADVMNS
SELYALWQNEVYMMRDRIRAMRQKLYGVLTARIPDRDFTYFIKQRGMFGY
TGLSVGQVRRLRDEFAVYLLDSGRMCVAGLNTSNITYVADALAEVLK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACCGACACATCGAATACTATCCCGGCGACCCGATTTTGAGTTTGGT
CGAAACCTTCAAAAACGACCCGCGCCCCGAAAAAGTCAATTTGAGCATAG
GCATTTATTTCGACGACGAAGGCAGAATGCCCGTATTGGAATCCGTAAGC
CGTGCCGAAACCGCCCGTGCCGCCGCGCCAGCGCCGTCGCCCTACCTGCC
GATGGAGGGTTTGGACGTTTACCGCAGCGCGGTGCAGCATTTGTTGTTCG
GCAAAGGCAACCCCGCGCTCGCGCAGGGACGCATCGTTACCGTACAGACT
CTGGGCGGCTCGGGCGCGCTCAAAGTCGGGGCGGATTTCCTGCACCGCTG
GTTTCCCGAAGCGCGCGCCTACGTCAGCGATCCGACTTGGGACAACCATC
GCGGCATTTTTGAAGGCGCAGGTTTCGAGGTCGGCACTTACCCATATTAC
GACCCTGCCACTGTCGGCGTGAAATTCGACGAAATGACCGCGTTTTTCAA
CACCCTGCCCGAAAACAGCGTCCTCATCCTCCATCCCTGCTGCCACAACC
CGACCGGCGTGGATATGTCGGAACGGCAATGGGACGAAGTGTTGCAGATC
ATCAAAACGCGCAAACTGATTCCGTTTATGGACATCGCCTACCAAGGCTT
CGGCGGCGATTTGGACAGCGATGCCTACGCCGTCCGCAAAGCGGTGGAAA
TGGATTTGCCGCTGTTTGTCAGCAATTCGTTTTCAAAAAACCTGTCGCTC
TACGGCGAACGCGTCGGCGGCTTAAGCGTGGTTTGCCCCAATAAAGAAGA
AGCGGATTTGGTGTTCGGACAACTCAAATTCACCGTCCGCCGCATCTACT
CCAGCCCGCCCGCGCACGGCGCGTATATCGCCGCCGACGTGATGAACAGC
TCCGAACTTTACGCCTTGTGGCAAAACGAAGTTTATATGATGCGCGACCG
CATCCGTGCGATGCGGCAGAAACTTTACGGCGTATTGACCGCCCGAATCC
CCGACCGCGATTTCACTTATTTCATCAAACAGCGCGGAATGTTCGGCTAC
ACGGGGTTGAGCGTGGGGCAAGTCCGCAGGTTGCGCGACGAATTTGCCGT
TTACCTGCTGGATTCCGGCAGGATGTGCGTCGCCGGGCTGAATACATCAA
ATATCACTTATGTCGCCGATGCGCTTGCCGAAGTGTTGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy