Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR1076 IGR1077 IGR1079 IGR1082 IGR1080 IGR1078 IGR1083 IGR1081 NG1326 cycB, - NG1328 tyrB, - NG1329 NG1327 NG1324 NG1321 tesA,apeA,pldC, - NG1323 pqiB, - NG1320 gcvP,gcvHP, - NG1325 NG1326 cycB, - NG1328 tyrB, - NG1329 NG1327 NG1324 NG1321 tesA,apeA,pldC, - NG1323 pqiB, - NG1320 gcvP,gcvHP, - NG1325 Type: direct, Name:  - 132 Type: direct, Name:  - 134 NG1326 cycB, - NG1328 tyrB, - NG1329 NG1327 NG1324 tesA,apeA,pldC, - NG1323 pqiB, - NG1320 gcvP,gcvHP, - NG1325 tagI,tag, - NG1322 tagI,tag, - NG1322 NG1321
* Calculated from Protein Sequence

Gene ID: NG1325

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcvP  gcvHP  

Definition:
glycine dehydrogenase

Gene Start:
1281816

Gene Stop:
1284665

Gene Length:
2850

Molecular Weight*:
104078

pI*:
5.80

Net Charge*:
-20.35

EC:
1.4.4.2  

Functional Class:
Central intermediary metabolism; Glycine cleavage system  

Pathway: pathway table
Glycine, serine and threonine metabolism

Secondary Evidence:
Stauffer,L.T., Fogarty,S.J. and Stauffer,G.V.
Characterization of the Escherichia coli gcv operon.
Gene 142, 17-22 (1994)
M:94237484

Stauffer LT, Stauffer GV.
Role for the leucine-responsive regulatory protein (Lrp) as a structural protein in regulating the Escherichia coli gcvTHP operon.
Microbiology. 1999 Mar;145 ( Pt 3):569-76.
PMID: 10217490

Turner SJ, Lewis GD, Bellamy AR.
A genomic polymorphism located downstream of the gcvP gene of Escherichia coli that correlates with ecological niche.
Mol Ecol. 1997 Nov;6(11):1019-32.
PMID: 9394461

Okamura-Ikeda K, Ohmura Y, Fujiwara K, Motokawa Y.
Cloning and nucleotide sequence of the gcv operon encoding the Escherichia coli glycine-cleavage system.
Eur J Biochem. 1993 Sep;216(2):539-48.
PMID: 8375392

Comment:
Oklahoma ID: NGO.1325

The glycine cleavage system comprises four proteins: P,T,L and H.
The H protein is NG1404 and the T protein is NG1406. The L component may be NG09562.

Blast Summary:  PSI-Blast Search
Several matches to glycine dehydrogenases and glycine cleavage system P proteins. Residues 3-949 are 55% similar to the glycine decarboxylase in Escherichia coli O157:H7 (AP002563).

Residues 1-950 are virtually identical to NMA1934 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1003
COG name: Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain
Functional Class:  E
The phylogenetic pattern of COG1003 is ---kyqvcebr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003437 (Glycine cleavage system P-protein) with a combined E-value of 8.1e-186.
    IPB003437A    94-136
    IPB003437B    558-604
    IPB003437C    665-718
    IPB003437D    744-796
    IPB003437E    831-872
    IPB003437A    510-552


ProDom Summary:  Protein Domain Search
Residues 539-787 are 43% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in GCSP_SOLTU.

Residues 448-534 are 62% similar to a (GLYCINE DEHYDROGENASE DECARBOXYLATING) protein domain (PD003319) which is seen in P74416_SYNY3.

Residues 790-945 are 67% similar to a (GLYCINE DEHYDROGENASE DECARBOXYLATING) protein domain (PD003536) which is seen in GCSP_ECOLI.

Residues 16-123 are 54% similar to a (GLYCINE DEHYDROGENASE DECARBOXYLATING) protein domain (PD003559) which is seen in P74416_SYNY3.

Residues 124-275 are 47% similar to a (GLYCINE DEHYDROGENASE DECARBOXYLATING) protein domain (PD149802) which is seen in GCSP_ECOLI.

Residues 301-433 are 58% similar to a (GLYCINE DEHYDROGENASE DECARBOXYLATING) protein domain (PD186164) which is seen in GCSP_PEA.

Residues 717-788 are 50% similar to a (GLYCINE DEHYDROGENASE DECARBOXYLATING) protein domain (PD150885) which is seen in GCSP_ECOLI.



Paralogs:  Local Blast Search


NG1325 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 437 (E-value = 5.4e-226) place NG1325 in the GDC-P family which is described as Glycine cleavage system P-protein (PF02347)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
233  
249
non-globular  
350  
464
non-globular  
670  
765

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKLSELFNPNEFAARHLSFGDEAALLAAVGEKSMDEFVGNTLPQSIRMPS
ELDLPEALTEADALAKLKGIASKNVINKSYIGLGYYPTRVPNVILRNVLE
NPGWYTAYTPYQAEIAQGRLEALLNFQQVCIDLTGFPVAGASLLDEATAA
AEAMAMAHRVGKVKSERFFVDARVYPQTLDVMKTRAKYFGFELVVSDFAQ
ADEGEYFGALFQYVGKDGDVQDLQDVIGRLKAKGTIVAVAADIMSLVLLK
SPAELGADIALGNTQRFGVPMGFGGPHAAYFAFKDEFKRSAPGRIIGVSK
DASGKPALRMALSTREQHIRREKATSNICTAQALLANLAGMYAVYHGPKG
VKRIANRIHTLASVFADALVSDGLKVVHEVFFDTVTVDFGSKEKADQVFA
AALESGYNLRSVNNTQVAAAFHETSVYEDLADLYRAFTGKDTFTFADDVK
GRLNAELLRQDDILQHPVYNSYHTEHEMLRYLKKLEDRDLAMNRSMISLG
SCTMKLNATAEMLPITWTEFSDIHPYAPEAQTAGYRELLADMENSLKAIT
GFDAISFQPNSGAQGEYSGMLAIRRYQEAQGEAHRNICLIPKSAHGTNPA
TAAMLGLKVVVVDTDEHGNVNIDDLKAKAEQHRDALSAIMITYPSTHGVY
EEGIRDICRIIHENGGQVYMDGANLNAQIGIMQPAEVGADVLHMNLHKTF
CIPHGGGGPGMGPIGLKAHLAPFAPGHTLTDTHSASAGQTSVAAAAFGSA
SILPITWMYLTMMGKQGMEQATRWALLNANYVAKRLSEDYPILYTGKNGR
IAHECIVDLRPLKAESGITETDIAKRLMDYGFHAPTVSFPVAGTLMIEPT
ESESKAELDRFIAALKSIRREVQKVIDGEWPKDDNPLVNAPHTAADITGE
WAHPYSREEAVFPLPFVREHKFWPFVNRVDDVYGDRNLVCSCPPMENYED


Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTGTCCGAACTGTTCAACCCCAACGAATTTGCCGCGCGGCATTT
GAGTTTCGGCGACGAAGCGGCGTTGCTTGCCGCTGTCGGCGAGAAGAGCA
TGGACGAATTTGTCGGCAACACCTTGCCGCAAAGCATCCGTATGCCGTCC
GAACTCGATTTGCCCGAAGCCCTGACCGAGGCGGACGCATTGGCGAAATT
GAAAGGCATCGCGTCTAAAAACGTGATCAACAAGTCCTATATCGGTTTGG
GTTATTACCCGACCCGCGTGCCGAACGTGATTTTGCGCAACGTATTGGAA
AACCCGGGCTGGTACACCGCCTACACGCCGTATCAGGCGGAGATTGCCCA
AGGTCGTTTGGAAGCGTTGTTGAACTTCCAGCAGGTGTGCATCGATTTGA
CCGGTTTCCCTGTGGCAGGCGCGTCTTTGTTGGACGAAGCGACCGCCGCC
GCCGAAGCGATGGCGATGGCGCACCGCGTGGGCAAAGTGAAATCCGAGCG
TTTCTTTGTGGATGCGCGCGTGTATCCGCAAACTTTGGACGTGATGAAAA
CCCGCGCCAAATATTTCGGCTTCGAGCTGGTGGTCAGCGATTTTGCCCAA
GCGGATGAAGGCGAATACTTCGGCGCGCTGTTCCAATACGTCGGTAAAGA
CGGCGACGTGCAAGACTTGCAGGACGTTATCGGCCGTCTGAAAGCCAAAG
GCACAATCGTTGCTGTTGCCGCCGACATCATGAGCTTGGTTTTGCTGAAG
TCTCCGGCTGAATTGGGCGCGGATATTGCTTTGGGCAACACCCAACGTTT
CGGCGTACCGATGGGCTTTGGTGGTCCGCACGCCGCTTATTTCGCGTTTA
AAGACGAGTTCAAACGCTCCGCCCCGGGCCGCATCATCGGCGTATCCAAA
GACGCATCGGGCAAACCTGCCTTGCGCATGGCTTTGTCCACCCGCGAACA
ACACATCCGCCGCGAAAAAGCGACATCCAATATTTGTACCGCACAGGCAT
TGCTGGCGAACTTGGCGGGCATGTACGCCGTTTATCACGGCCCCAAAGGC
GTAAAACGCATCGCCAACCGCATTCACACACTGGCTTCCGTCTTTGCCGA
CGCGCTGGTTTCAGACGGCCTCAAAGTGGTTCACGAAGTCTTCTTCGATA
CCGTTACCGTCGATTTCGGCAGCAAAGAGAAAGCAGACCAAGTGTTTGCC
GCTGCTTTGGAGTCGGGTTACAACCTGCGCAGCGTCAACAATACTCAAGT
TGCGGCTGCATTCCATGAAACGTCGGTATACGAAGATTTGGCCGATTTGT
ACCGCGCGTTTACCGGCAAGGATACGTTCACATTTGCCGATGATGTCAAA
GGCCGTCTGAATGCCGAATTACTGCGTCAAGACGACATTCTGCAACATCC
TGTGTACAACAGTTACCACACCGAACACGAAATGTTGCGCTACCTGAAAA
AACTCGAAGACCGCGACTTGGCTATGAACCGCAGCATGATTTCGCTCGGG
AGCTGCACCATGAAGCTCAATGCGACTGCGGAAATGTTGCCGATTACTTG
GACTGAGTTCTCCGACATCCACCCTTACGCTCCCGAAGCGCAAACCGCCG
GCTACCGCGAATTGCTTGCTGATATGGAAAACAGCCTGAAAGCCATCACC
GGCTTTGACGCGATTTCCTTCCAGCCCAACTCCGGCGCACAAGGCGAATA
CAGCGGTATGCTCGCCATCCGCCGTTATCAGGAAGCCCAAGGCGAAGCAC
ACCGCAACATCTGCCTGATTCCCAAATCCGCCCACGGCACCAACCCCGCC
ACCGCCGCCATGCTCGGTTTGAAAGTCGTCGTCGTCGATACCGACGAACA
CGGCAACGTCAATATTGACGATTTGAAAGCCAAAGCCGAACAACACCGCG
ATGCCTTGTCCGCCATCATGATTACCTATCCGTCCACACACGGCGTGTAC
GAAGAAGGCATCCGCGACATCTGCCGGATCATTCACGAAAACGGCGGACA
GGTTTACATGGACGGCGCAAACCTCAATGCCCAAATCGGCATCATGCAGC
CCGCCGAAGTCGGCGCGGACGTGTTGCACATGAACCTGCACAAAACCTTC
TGTATCCCTCACGGCGGCGGCGGCCCGGGCATGGGTCCGATTGGCTTGAA
AGCCCACCTCGCCCCGTTCGCACCGGGGCATACCCTGACCGACACCCACA
GCGCAAGTGCCGGGCAAACCTCCGTTGCCGCCGCAGCCTTCGGTTCTGCA
TCCATCCTGCCGATTACTTGGATGTACCTGACCATGATGGGCAAACAAGG
CATGGAACAGGCAACACGCTGGGCATTGCTCAACGCCAACTATGTCGCTA
AACGCTTGAGCGAAGACTATCCGATTCTGTATACAGGCAAAAACGGCCGC
ATCGCGCACGAATGCATCGTCGATTTGCGTCCGCTCAAAGCCGAAAGCGG
CATCACCGAAACCGACATCGCCAAACGCCTGATGGACTACGGCTTCCACG
CGCCGACGGTTTCCTTCCCTGTTGCCGGCACGCTGATGATCGAACCGACC
GAGAGCGAAAGCAAAGCCGAACTCGACCGCTTCATCGCCGCCCTGAAATC
CATTCGCCGCGAAGTGCAGAAAGTCATCGACGGCGAATGGCCGAAAGACG
ACAACCCACTGGTCAACGCGCCGCACACCGCCGCAGATATAACCGGCGAA
TGGGCGCATCCGTACTCTCGCGAAGAAGCCGTCTTCCCGCTGCCCTTCGT
GCGCGAACACAAGTTCTGGCCCTTCGTCAACCGCGTGGACGACGTGTACG
GCGACCGCAACCTCGTGTGCAGCTGCCCGCCGATGGAAAATTATGAAGAC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy