Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1076 IGR1077 IGR1079 IGR1080 IGR1078 IGR1075 IGR1081 NG1326 hemO, - NG1318 NG1327 NG1324 NG1321 tesA,apeA,pldC, - NG1323 pqiB, - NG1320 gcvP,gcvHP, - NG1325 NG1326 hemO, - NG1318 NG1327 NG1324 NG1321 tesA,apeA,pldC, - NG1323 pqiB, - NG1320 gcvP,gcvHP, - NG1325 Type: direct, Name:  - 132 Type: direct, Name:  - 134 NG1326 hemO, - NG1318 NG1327 NG1324 tesA,apeA,pldC, - NG1323 pqiB, - NG1320 gcvP,gcvHP, - NG1325 tagI,tag, - NG1322 pqiA, - NG1319 tagI,tag, - NG1322 pqiA, - NG1319 NG1321
* Calculated from Protein Sequence

Gene ID: NG1323

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tesA  apeA  pldC  

Definition:
acyl-CoA thioesterase I (lysophospholipase I)

Gene Start:
1280614

Gene Stop:
1281252

Gene Length:
639

Molecular Weight*:
22948

pI*:
10.30

Net Charge*:
7.39

EC:
3.1.2.-  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table

Secondary Evidence:
Cho,H. and Cronan,J.E.
Escherichia coli thioesterase I, molecular cloning and sequencing
of the structural gene and identification as a periplasmic enzyme. J. Biol. Chem. 268, 9238-9245 (1993)
M:93252782

Karasawa K, Yokoyama K, Setaka M, Nojima S.
The Escherichia coli pldC gene encoding lysophospholipase L(1) is identical to the apeA and tesA genes encoding protease I and
thioesterase I, respectively.
J Biochem (Tokyo). 1999 Aug;126(2):445-8.
PMID: 10423542

Ichihara,S., Matsubara,Y., Kato,C., Akasaka,K. and Mizushima,S.
Molecular cloning, sequencing, and mapping of the gene encoding
protease I and characterization of proteinase and
proteinase-defective Escherichia coli mutants
J. Bacteriol. 175 (4), 1032-1037 (1993)
MEDLINE: 93163029

Karasawa,K., Kudo,I., Kobayashi,T., Homma,H., Chiba,N.,
Mizushima,H., Inoue,K. and Nojima,S.
Lysophospholipase L1 from Escherichia coli K-12 overproducer
J. Biochem. 109 (2), 288-293 (1991)
MEDLINE: 91324311




Comment:
Oklahoma ID: NGO.1323

Blast Summary:  PSI-Blast Search
Limited matches in gapped BLAST to acyl-CoA thioesterase I sequences. Residues 33-201 are 36% similar to the enzyme from Caulobacter crescentus (gb|AAK23736).

Residues 1-213 are virtually identical to NMB1674, a predicted GDSL lipase family protein in N.meningitidis (gb|AAF42023).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB001087 (GDSL lipolytic enzyme) with a combined E-value of 1.1e-06.
    IPB001087A    39-51
    IPB001087B    105-110
    IPB001087C    181-197


ProDom Summary:  Protein Domain Search
Residues 40-192 are 35% similar to a (PRECURSOR HYDROLASE SIGNAL ARYLESTERASE) protein domain (PD036745) which is seen in TESA_ECOLI.



Paralogs:  Local Blast Search


NG1323 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 41 to 203 (E-value = 1.4e-35) place NG1323 in the Lipase_GDSL family which is described as GDSL-like Lipase/Acylhydrolase (PF00657)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
transmembrane  
134  
150

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPSEKPMNRRTFLLGAGALLLTACGRKSARTHAKIPEGSTVLALGDSLTF
GYGANPGESYPAQLQKLTGWNIVNGGVSGDTSAQALSRLPALLARKPKLV
IVGIGGNDFLRKVPEEQTRANIAKIIETVQKENIPAVLVGVPHITLGALF
GHLSDHPLYEDLSEEYGIPLFGGAWAEILGNNNLKSDQIHANGKGYRKFA
ENLNQFLRKHGFR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAAAACCAATGAACAGAAGAACCTTCCTCCTCGGCGCAGG
CGCGTTGCTTCTTACCGCCTGCGGCAGAAAATCCGCCCGAACCCACGCCA
AAATTCCCGAAGGAAGCACCGTGCTTGCCTTGGGCGATTCGCTCACCTTC
GGCTACGGAGCAAACCCCGGCGAATCCTACCCCGCGCAACTGCAAAAACT
GACGGGTTGGAATATTGTCAACGGCGGCGTATCGGGCGATACGTCCGCGC
AAGCCCTATCGCGCCTGCCCGCGCTGTTGGCACGCAAACCCAAGCTTGTG
ATTGTCGGCATAGGCGGCAACGACTTTCTGCGCAAAGTTCCCGAGGAGCA
GACCCGCGCCAATATCGCGAAAATCATCGAAACCGTGCAAAAGGAAAACA
TTCCCGCCGTCCTCGTCGGCGTGCCGCACATCACACTGGGCGCGTTGTTC
GGGCATTTGAGCGACCATCCGCTGTATGAGGATTTGTCCGAGGAATACGG
CATTCCGTTGTTCGGCGGCGCGTGGGCGGAAATTTTGGGCAATAATAATC
TGAAATCCGACCAAATCCACGCCAACGGCAAAGGCTATCGGAAATTCGCC
GAAAATTTGAATCAATTTTTGAGAAAACATGGGTTTAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy