Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1076 IGR1077 IGR1074 IGR1079 IGR1080 IGR1078 IGR1075 IGR1081 NG1326 hemO, - NG1318 NG1324 NG1321 tesA,apeA,pldC, - NG1323 tpn, - NG1317 pqiB, - NG1320 gcvP,gcvHP, - NG1325 NG1326 hemO, - NG1318 NG1324 NG1321 tesA,apeA,pldC, - NG1323 tpn, - NG1317 pqiB, - NG1320 gcvP,gcvHP, - NG1325 Type: direct, Name:  - 132 Type: direct, Name:  - 134 NG1326 hemO, - NG1318 NG1324 tesA,apeA,pldC, - NG1323 tpn, - NG1317 pqiB, - NG1320 gcvP,gcvHP, - NG1325 tagI,tag, - NG1322 pqiA, - NG1319 tagI,tag, - NG1322 pqiA, - NG1319 NG1321
* Calculated from Protein Sequence

Gene ID: NG1322

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tagI  tag  

Definition:
DNA-3-methyladenineglycosylase I

Gene Start:
1280073

Gene Stop:
1280621

Gene Length:
549

Molecular Weight*:
21001

pI*:
7.30

Net Charge*:
0.83

EC:
3.2.2.20  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Chaudhuri I, Essigmann JM.
3-Methyladenine mutagenesis under conditions of SOS induction in Escherichia coli.
Carcinogenesis. 1991 Dec;12(12):2283-9.
PMID: 1747928

Steinum,A.L. and Seeberg,E.
Nucleotide sequence of the tag gene from Escherichia coli
Nucleic Acids Res. 14 (9), 3763-3772 (1986)
MEDLINE: 86232617


Comment:
Oklahoma ID: NGO.1322

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to DNA-3-methyladenine glycosidase I sequences. Residues 20-166 are 37% similar to the enzyme in Lactococcus lactis subsp. lactis (gb|AAK05220).

Residues 1-183 are virtually identical to NMA1931 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-166 are 37% similar to a (TAG DNA-3-METHYLADENINE GLYCOSYLASE I) protein domain (PD013429) which is seen in O05311_MYCTU.



Paralogs:  Local Blast Search


NG1322 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 171 (E-value = 4e-31) place NG1322 in the Adenine_glyco family which is described as Methyladenine glycosylase (PF03352)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1LMZ|1LMZ-A SOLUTION STRUCTURE OF 3-METHYLADENINE DNA 99.8 3e-22

Gene Protein Sequence:
VNYCEFAASLPENTDNPNKHYHDTQYGFPIKDDNGLFERLVLEINQAGLS
WTLMLKKRQAFQTAFEGFDIDTVAAFGEADIERLLTDAGIVRNRLKIDAA
IFNARQIQALQQEHGSFKNWLDAHHPRSKDEWVKLFKKHFKFVGGEIVGE
FLMSTGYLKGAHAESCPVYRKTLKYHPKWLDAV

Gene Nucleotide Sequence:  Sequence Viewer
GTGAACTATTGCGAATTTGCCGCCTCACTTCCCGAAAACACCGACAACCC
GAACAAACATTACCACGATACGCAATACGGTTTTCCGATTAAGGACGACA
ACGGACTGTTTGAACGGCTGGTGTTGGAAATCAATCAGGCAGGATTAAGT
TGGACGCTGATGCTGAAGAAGCGGCAGGCGTTTCAGACGGCATTTGAAGG
TTTCGACATCGATACGGTCGCCGCATTTGGCGAAGCCGATATTGAACGGC
TGCTTACCGATGCGGGTATTGTCCGCAACCGTCTGAAAATCGATGCCGCC
ATTTTCAATGCACGGCAAATCCAAGCGTTGCAACAAGAACACGGTTCGTT
CAAGAACTGGCTCGACGCGCACCATCCGCGAAGCAAAGACGAATGGGTCA
AACTCTTTAAAAAACATTTCAAATTCGTCGGCGGCGAAATCGTCGGCGAA
TTTCTGATGAGTACCGGCTACCTCAAAGGCGCGCACGCCGAAAGCTGTCC
GGTTTACCGTAAAACCCTGAAATACCACCCGAAATGGCTCGATGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy