Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1074 IGR1070 IGR1069 IGR1067 IGR1066 IGR1068 IGR1073.1 IGR1072 IGR1071 IGR1073.2 IGR1073 rpoZ, - NG1309 gmk,kguA, - NG1310 hemO, - NG1318 NG1312 tbpA,hmbR, - NG1316.1 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 tpn, - NG1317 NG1314 rpoZ, - NG1309 gmk,kguA, - NG1310 hemO, - NG1318 NG1312 tbpA,hmbR, - NG1316.1 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 tpn, - NG1317 NG1314 rpoZ, - NG1309 gmk,kguA, - NG1310 hemO, - NG1318 NG1312 tbpA,hmbR, - NG1316.1 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 tpn, - NG1317 NG1314
* Calculated from Protein Sequence

Gene ID: NG1314

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
protease, undefined

Gene Start:
1270191

Gene Stop:
1271543

Gene Length:
1353

Molecular Weight*:
50798

pI*:
6.30

Net Charge*:
-5.06

EC:
3.4.-.-  

Functional Class:
Unassigned  

Pathway: pathway table
Biotin metabolism
Lysine degradation

Comment:
Oklahoma ID: NGO.1314

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to proteinases and hypotheticals. Residues 1-441 are 57% similar to a hypothetical in E.coli (gb|AAG57144).

Residues 1-451 are virtually identical to NMB1664 in N.meningitidis (gb|AAF42013).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0826
COG name: Protease related to collagenase
Functional Class:  O
The phylogenetic pattern of COG0826 is -MT--q--EB-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001539 (Peptidase family U32) with a combined E-value of 5.5e-59.
    IPB001539A    5-30
    IPB001539B    159-199
    IPB001539C    295-320


ProDom Summary:  Protein Domain Search
Residues 349-441 are 43% similar to a (PUTATIVE PROTEASE PROTEIN HYDROLASE) protein domain (PD040681) which is seen in YEGQ_ECOLI.

Residues 266-348 are 75% similar to a (PROTEASE PROTEIN HYDROLASE PUTATIVE) protein domain (PD004398) which is seen in YEGQ_ECOLI.



Paralogs:  Local Blast Search


NG1314 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 76 to 355 (E-value = 3e-144) place NG1314 in the Peptidase_U32 family which is described as Peptidase family U32 (PF01136)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKAPELLLPAGGLERMRAAYDYGADAVYAGSPRYSLRARNNEFAKLDVLE
QGIKEAHERNKKFFLTVNTLPHNSKLKTFVADMEPLIAMKPDALIMADPG
LIMTVREKWPEMPIHLSVQANTTNYWGVKFWQNIGVERIILSRELGMEEI
AEIRQECPDIELEVFIHGALCIAYSGRCLLSGYFNHRDPNQGTCTNSCRW
DYKVHNATESEAGDAQLLQGFNFEKAQEEANQNFEGINGQKRHPYADKVF
LIEESNRPGEMMPIMEDEHGTYIMNSKDLRGIEVVEKLAKIGVDSLKVEG
RTKSLYYVARVAQSYRKAIHDAVAGRPFDYSLLSELEGLANRGYTSGFLE
RHQTQDYQNYLSGHSTAKQSQYVGHVTEIDENGWATIEVKNRFAVGDSLE
IIHPSGNQTIKLEQMTRKGQPVDVAPGNGIQVKIPNMQGKEKALIARVLN
P

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGCACCCGAACTCTTATTGCCCGCCGGCGGATTGGAAAGAATGCG
CGCCGCCTACGATTACGGCGCAGATGCCGTTTACGCCGGCAGCCCGCGTT
ACTCCCTGCGCGCCCGCAACAACGAATTTGCCAAACTCGACGTCCTCGAG
CAAGGCATTAAAGAAGCGCACGAACGCAACAAAAAATTCTTTTTGACCGT
CAACACCCTGCCGCACAATTCCAAACTCAAAACCTTCGTTGCCGACATGG
AGCCGCTGATTGCCATGAAACCCGACGCGCTGATTATGGCGGATCCGGGT
TTGATTATGACCGTGCGCGAAAAATGGCCGGAAATGCCGATCCATCTGTC
CGTACAGGCGAACACCACCAACTACTGGGGCGTGAAATTTTGGCAGAACA
TTGGTGTCGAACGCATCATCCTGTCACGCGAATTGGGCATGGAAGAAATT
GCCGAAATCCGCCAAGAATGCCCCGACATCGAACTCGAAGTCTTCATCCA
CGGCGCATTGTGCATCGCCTACTCAGGCCGCTGCCTGTTGTCGGGCTATT
TCAACCACCGCGATCCCAACCAAGGCACCTGCACCAACTCCTGCCGTTGG
GACTACAAAGTCCACAACGCCACGGAAAGCGAGGCAGGCGATGCCCAGCT
TCTGCAAGGTTTCAACTTTGAAAAAGCCCAAGAAGAAGCCAACCAAAACT
TTGAAGGCATCAACGGTCAAAAACGCCATCCCTACGCCGACAAAGTTTTC
CTGATTGAAGAATCCAACCGCCCGGGCGAGATGATGCCGATTATGGAAGA
CGAACACGGCACCTACATCATGAACTCCAAAGATCTTCGCGGTATCGAAG
TCGTCGAAAAACTCGCCAAAATCGGTGTGGACAGCCTCAAAGTCGAAGGC
CGTACCAAGTCTCTCTACTACGTCGCCCGCGTCGCCCAGTCCTACCGCAA
AGCGATTCACGATGCCGTCGCAGGCCGTCCGTTTGATTACAGCCTGTTGA
GCGAACTCGAAGGCCTTGCCAACCGAGGCTACACCAGCGGCTTCCTCGAA
CGCCACCAAACTCAGGATTATCAAAACTACCTCAGCGGCCATTCCACCGC
CAAACAAAGCCAATACGTCGGACACGTTACCGAAATCGACGAAAATGGCT
GGGCGACCATCGAAGTTAAAAACCGCTTCGCCGTCGGCGATTCGCTCGAA
ATCATCCACCCGAGCGGCAACCAAACCATCAAATTGGAACAAATGACCCG
CAAAGGCCAACCTGTCGATGTTGCCCCGGGCAACGGCATTCAGGTCAAAA
TCCCCAATATGCAGGGCAAAGAAAAAGCCCTCATCGCACGCGTGTTGAAC
CCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy