Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1070 IGR1069 IGR1067 IGR1065 IGR1064 IGR1066 IGR1068 IGR1072 IGR1071 IGR1073 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314 Type: direct, Name:  - 101 Type: direct, Name:  - 105 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314
* Calculated from Protein Sequence

Gene ID: NG1311

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aprt  apt  

Definition:
adenine phosphoribosyltransferase

Gene Start:
1268433

Gene Stop:
1269029

Gene Length:
597

Molecular Weight*:
21594

pI*:
6.10

Net Charge*:
-2.08

EC:
2.4.2.7  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Hershey,H.V. and Taylor,M.W.
Nucleotide sequence and deduced amino acid sequence of Escherichia coli adenine phosphoribosyltransferase and comparison with other analogous enzymes
Gene 43 (3), 287-293 (1986)
M:86301884


Comment:
Oklahoma ID: NGO.1311

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to adenine phosphoribosyltransferase sequences. Residues 24-195 are 52% similar to the enzyme from Rhizobium galegae (gb|AAF14237).

Residues 1-199 are virtually identical to NMA1920 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0503
COG name: Adenine/guanine phosphoribosyltransferases
Functional Class:  F
The phylogenetic pattern of COG0503 is -mtkY-vcEBrHujgpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002375 (Purine/pyrimidine phosphoribosyl transferase) with a combined E-value of 3.8e-09.
    IPB002375A    99-103
    IPB002375B    132-147


ProDom Summary:  Protein Domain Search
Residues 117-190 are 50% similar to a (TRANSFERASE GLYCOSYLTRANSFERASE) protein domain (PD000249) which is seen in APT_PSEST.

Residues 57-116 are 63% similar to a (TRANSFERASE ADENINE GLYCOSYLTRANSFERASE) protein domain (PD001933) which is seen in APT_HELPY.



Paralogs:  Local Blast Search


NG1311 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 43 to 180 (E-value = 7.1e-46) place NG1311 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
72  
88

PDB Hit:
pdb|1G2P|1G2P-A CRYSTAL STRUCTURE OF ADENINE 128.0 9e-31
pdb|1L1Q|1L1Q-A CRYSTAL STRUCTURE OF APRTASE FROM GIARDIA 97.5 2e-21
pdb|1QB7|1QB7-A CRYSTAL STRUCTURES OF ADENINE 94.0 2e-20
pdb|1L1Q|1L1Q-A CRYS

Gene Protein Sequence:
MALKTSNLEHAMLVHPEAMSVGALADKIRKIENWPQKGILFHDITPVLQS
AEYFRLLVDLLVYRYMDQKIDIVAGLDARGFIIGAALAYQLNVGFVPIRK
KGKLPFETVSQSYALEYGEAAVEIHTDAVKPGSRVLLVDDLVATGGTMLA
GLELIRKLGGEIVEAAAILEFTDLQGGKNIRASGAPLFTLLQNEGCMKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGTTAAAAACATCAAACTTGGAACACGCAATGCTGGTTCATCCCGA
AGCTATGAGTGTCGGCGCGCTTGCCGACAAAATCCGCAAAATCGAAAACT
GGCCGCAAAAAGGCATCTTATTCCACGACATCACGCCCGTCCTGCAAAGT
GCGGAATACTTCCGCCTTTTGGTCGATTTGCTGGTTTACCGCTATATGGA
TCAGAAAATCGACATCGTTGCCGGCTTGGACGCGCGCGGCTTCATTATCG
GCGCGGCACTCGCCTACCAGCTCAACGTCGGCTTCGTCCCCATCCGCAAA
AAAGGCAAGCTGCCTTTTGAAACCGTATCGCAAAGCTACGCGCTCGAATA
CGGGGAAGCTGCGGTGGAAATCCACACCGATGCCGTCAAACCCGGTTCGC
GCGTCCTGCTGGTCGATGATTTGGTTGCCACGGGCGGCACAATGCTTGCC
GGGCTGGAACTGATCCGCAAACTCGGCGGGGAAATTGTCGAAGCCGCCGC
CATTTTGGAATTTACCGACCTTCAAGGCGGCAAGAATATCCGCGCAAGTG
GCGCGCCCTTATTTACCCTGCTTCAAAACGAAGGCTGCATGAAAGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy