Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap rRNA-16S-2 IGR1070 IGR1069 IGR1067 IGR1064 IGR1065 IGR1066 IGR1068 IGR1072 IGR1071 IGR1073 IGR1063 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314 Type: direct, Name:  - 101 Type: direct, Name:  - 105 Type: direct, Name:  - 109 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 tbpA, - NG1316 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314
* Calculated from Protein Sequence

Gene ID: NG1310

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gmk  kguA  

Definition:
guanylate kinase (KguA) (GMP kinase)

Gene Start:
1268329

Gene Stop:
1267691

Gene Length:
639

Molecular Weight*:
23412

pI*:
6.30

Net Charge*:
-2.60

EC:
2.7.4.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Gentry,D., Bengra,C., Ikehara,K. and Cashel,M.
Guanylate kinase of Escherichia coli K-12. J. Biol. Chem. 268 (19), 14316-14321 (1993)
M:93300828


Comment:
For other 'gua' genes see NG2164 (guaA).

Oklahoma ID: NGO.1310c

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to guanylate kinase sequences. Residues 14-202 are 52% similar to KGUA_HAEIN (gb|AAC23390).

Residues 9-213 are virtually identical to NMA1919 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0194
COG name: Guanylate kinase
Functional Class:  F
The phylogenetic pattern of COG0194 is ----yqvcEbrhujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000619 (Guanylate kinase) with a combined E-value of 1.4e-50.
    IPB000619A    18-35
    IPB000619B    46-67
    IPB000619C    69-121


ProDom Summary:  Protein Domain Search
Residues 120-202 are 40% similar to a (KINASE GUANYLATE GMP TRANSFERASE) protein domain (PD003452) which is seen in KGUA_ECOLI.

Residues 57-117 are 66% similar to a (PROTEIN KINASE DOMAIN SH3 GUANYLATE GMP TRANSFERASE) protein domain (PD001338) which is seen in KGUA_HAEIN.

Residues 17-163 are 28% similar to a (PLASMID PLS32 DNA FOR) protein domain (PD102593) which is seen in O52944_BACSU.



Paralogs:  Local Blast Search


NG1310 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 50 to 154 (E-value = 1.2e-48) place NG1310 in the Guanylate_kin family which is described as Guanylate kinase (PF00625)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
152  
187

PDB Hit:
pdb|1EX6|1EX6-A CRYSTAL STRUCTURE OF UNLIGANDED FORM OF 129.0 3e-31
pdb|1LVG|1LVG-A CRYSTAL STRUCTURE OF MOUSE GUANYLATE KINASE IN 121.0 9e-29
pdb|1KGD|1KGD-A CRYSTAL STRUCTURE OF THE GUANYLATE KINASE-LIKE 65.2 9e-12
pdb|1JXM|1JXM-A CRYS

Gene Protein Sequence:
LENIQVKNMSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTT
RPPREGEANGVHYHFVSKEEFESLIAQEAFLEYADVFGNYYGTSTEGVNA
LAAAGYDVILEIDVQGAAQVRNALPEAVGIFILPPSFDVLAARLKGRGTD
SREVIQRRLSKARHEIEQSVLFDFVVVNDDLEKAEGDLLHIVNACRLKRS
RQLGFIADLLENS

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAAAATATACAGGTAAAAAATATGTCCGCTTATCGAAAAGGCAACAT
CTTTATCATTTCGGCCGCTTCCGGCACGGGCAAAACCACGCTGGTGTCGC
GGCTGTTGGCAAACCATAACGGTTTGCGCGTTTCCGTGTCGCATACGACG
CGCCCGCCGCGTGAAGGCGAAGCAAACGGCGTACATTATCACTTTGTTTC
CAAAGAAGAGTTTGAATCGCTTATCGCGCAGGAGGCTTTTTTGGAATACG
CAGACGTATTCGGCAACTATTACGGCACAAGCACGGAGGGCGTGAATGCG
TTGGCGGCGGCAGGCTATGACGTGATTTTGGAAATCGACGTTCAGGGCGC
GGCGCAGGTTCGCAACGCGCTGCCGGAAGCTGTCGGTATCTTTATCCTGC
CGCCTTCTTTCGACGTGCTTGCCGCGCGCCTCAAAGGGCGCGGGACGGAC
AGTCGGGAAGTTATCCAAAGGAGGCTGTCGAAGGCAAGGCATGAAATCGA
ACAGTCCGTATTGTTCGACTTTGTCGTGGTCAATGACGACCTGGAGAAGG
CGGAGGGGGATTTGCTTCATATTGTGAATGCCTGCCGTCTGAAAAGGTCG
CGGCAACTGGGATTTATTGCAGATTTGTTGGAAAATTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy