Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap rRNA-16S-2 IGR1070 IGR1069 IGR1067 IGR1064 IGR1065 IGR1066 IGR1068 IGR1072 IGR1071 IGR1073 IGR1063 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314 Type: direct, Name:  - 101 Type: direct, Name:  - 105 Type: direct, Name:  - 109 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 spoT, - NG1308 NG1313 NG1315 aprt,apt, - NG1311 dfp, - NG1307 NG1314
* Calculated from Protein Sequence

Gene ID: NG1309

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoZ  

Definition:
DNA-directed RNA polymerase, omega subunit

Gene Start:
1267630

Gene Stop:
1267427

Gene Length:
204

Molecular Weight*:
7482

pI*:
9.50

Net Charge*:
2.42

EC:
2.7.7.6  

Functional Class:
Transcription; RNA synthesis, modification, and DNA transcription  
Transcription; Transcription factors  

Pathway: pathway table
Purine metabolism
Pyrimidine metabolism
RNA polymerase

Secondary Evidence:
Sarubbi,E., Rudd,K.E., Xiao,H., Ikehara,K., Kalman,M. and Cashel,M.
Characterization of the spoT gene of Escherichia coli.
J. Biol. Chem. 264 (25), 15074-15082 (1989)
Medline: 89359321.
Engel,J.N., Pollack,J., Malik,F. and Ganem,D. Cloning and characterization of RNA polymerase core subunits of Chlamydia trachomatis by using the polymerase chain reaction J. Bacteriol. 172 (10), 5732-5741 (1990) Medline: 91008945.
Ovchinnikov,Yu.A., Monastyrskaya,G.S., Gubanov,V.V., Guryev,S.O., Salomatina,I.S.,
Shuvaeva,T.M., Lipkin,V.M. and Sverdlov,E.D. The primary structure of E. coli RNA polymerase, Nucleotide sequence of the rpoC gene and amino acid sequence of the beta'-subunit Nucleic Acids Res. 10 (13), 4035-4044 (1982) Medline: 82274235.
Borodin,A.M., Danilkovich,A.V., Chernov,I.P., Azhikina,T.L. and Rostapshov,V.M. Genes coding for RNA polymerase in bacteria. III. The use of modified Sanger's method for sequencing the C-terminal region of rpoB gene, N-terminal region of rpoC gene and intercistron region of RNA polymerase in Pseudomonas putida Bioorg. Khim. 14 (9), 1179-1182 (1988) Medline: 89117617

Comment:
Oklahoma ID: NGO.1309c

For other 'rpo' genes, see NG0999 (rpoD), NG0288 (rpoH), NG1818 (rpoA), NG1850 (rpoC), NG1851 (rpoB).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to RNA polymerases omega subunits. Residues 1-64 are 53% similar to the omega subunit in V.cholerae (gb|AAF95849).

Residues 1-68 are identical to NMA1918 in N.meningitidis (gb|AAF42009).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1758
COG name: RNA polymerase-associated protein RpoZ, omega subunit
Functional Class:  K
The phylogenetic pattern of COG1758 is -----qv-ebrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003716 (RNA polymerase omega subunit) with a combined E-value of 2.2e-24.
    IPB003716A    1-31
    IPB003716B    37-60


ProDom Summary:  Protein Domain Search
Residues 1-64 are 55% similar to a (DNA-DIRECTED RNA POLYMERASE OMEGA) protein domain (PD027461) which is seen in RPOZ_ECOLI.



Paralogs:  Local Blast Search


NG1309 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 65 (E-value = 1.2e-17) place NG1309 in the RNA_pol_Rpb6 family which is described as RNA polymerase Rpb6 (PF01192)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MARITTEDCTGKISNHFDLTLVAARRARQLENGNTPLVDDVRNNKPTVTA
LREIAAGHIGTELLTRNK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACGTATTACCACCGAAGACTGTACCGGAAAAATTTCCAACCATTT
TGACCTGACATTGGTAGCGGCCCGTCGGGCCCGCCAGCTTGAAAATGGCA
ATACGCCGCTTGTGGACGATGTCCGCAATAACAAACCGACCGTTACCGCC
TTAAGGGAAATCGCAGCCGGGCATATCGGTACGGAACTGTTGACGCGCAA
TAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy