Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 tRNA-Ile-1 rRNA-16S-2 IGR1070 IGR1069 IGR1067 IGR1065 IGR1064 IGR1066 IGR1068 IGR1071 IGR1063 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 spoT, - NG1308 NG1313 aprt,apt, - NG1311 dfp, - NG1307 NG1314 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 spoT, - NG1308 NG1313 aprt,apt, - NG1311 dfp, - NG1307 NG1314 Type: direct, Name:  - 113 Type: direct, Name:  - 101 Type: direct, Name:  - 105 Type: direct, Name:  - 109 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 NG1312 spoT, - NG1308 NG1313 aprt,apt, - NG1311 dfp, - NG1307 NG1314
* Calculated from Protein Sequence

Gene ID: NG1308

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoT  

Definition:
guanosine-3',5'-bis(diphosphate)3'-pyrophosphohydrolase

Gene Start:
1267331

Gene Stop:
1265178

Gene Length:
2154

Molecular Weight*:
80152

pI*:
9.20

Net Charge*:
13.56

EC:
3.1.7.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Regulatory functions  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Sarubbi,E., Rudd,K.E., Xiao,H., Ikehara,K., Kalman,M. and Cashel,M.
Characterization of the spoT gene of Escherichia coli.
J. Biol. Chem. 264 (25), 15074-15082 (1989)
M:89359321

Comment:
Oklahoma ID: NGO.1308c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to guanosine 3',5'-bis(diphosphate) 3'-pyrophosphatase sequences. Residues 26-718 are 46% similar to SPOT_ECOLI (gb|AAA62003).

Residues 1-718 are virtually identical to NMA1917 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0317
COG name: Guanosine polyphosphate pyrophosphohydrolases/synthetases
Functional Class:  T,K
The phylogenetic pattern of COG0317 is -----qvcEbrHujgpo----
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 197-359 are 53% similar to a (HYDROLASE SYNTHETASE PROTEIN PPGPP) protein domain (PD002902) which is seen in SPOT_HAEIN.

Residues 36-183 are 62% similar to a (HYDROLASE PROTEIN SYNTHETASE GTP PYROPHOSPHOKINASE PPGPP) protein domain (PD002764) which is seen in SPOT_ECOLI.

Residues 396-507 are 61% similar to a (HYDROLASE SYNTHETASE GTP) protein domain (PD002918) which is seen in SPOT_ECOLI.



Paralogs:  Local Blast Search


NG1308 is paralogously related to NG1382 (GTP pyrophosphokinase) (1e-104).


Pfam Summary:  Pfam Search
Residues 58 to 157 (E-value = 5.5e-10) place NG1308 in the HD family which is described as HD domain (PF01966)
Residues 248 to 360 (E-value = 1.1e-67) place NG1308 in the RelA_SpoT family which is described as Region found in RelA / SpoT proteins (PF04607)
Residues 397 to 460 (E-value = 4.2e-27) place NG1308 in the TGS family which is described as TGS domain (PF02824)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
188  
228

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPAPQPSAPYDPLTAEARTLLFHTASYLKPEQQAELEKAVAYAFRAHDGQ
TRKSGDPYITHPIAVATQLALWHMDIQGLCAGVMHDVLEDTGVTKGEMAA
VFGNTVAEMVDGLSKLEKLKFEDHAEHQAESFRKLILAMTKDVRVIVVKL
ADRLHNMRTLGSMRPDKRRRIARETLEIYAQIANRIGLNNAYRELQDLSF
QNLHPNRYETLKKAMDKSRKNRQDVVGKVLRAFGQRLVGANIEAKIKGRE
KNLYGIHQKMMAKKLRFAEVMDIYGFRVIVNSIPACYAALGTLHTLYQPK
PGRFKDYIAIPKSNGYQSLHTILVGPYGLPIEVQIRTREMDAVAEGGIVG
HWSYKSDSKTVDQAVLHTNQWLKNILDLQASSANAIEFLEHVKVDLFPNE
IYILTPKGKILTLPKGATPVDFAYAVHTDIGHKTVAARVNNVMMPLRTKL
KTGDSVEIITSEHAKPNPAWLNFAVSGRARSAIRQYIKNLNRHDAVVLGE
SLLQKALSSLLPKDVLLSDGIKEKYLADLNDKQTSFEEVLYNVGMGHTLP
VYVAMHIAELAGEHFGSEVRLSSIKVDGQESGHIHFAECCHPVPGDSIRL
LLVKGKGMIIHRDTCPTLLKSDPEQQLDADWENMNGQNYRVGLQVQSEDS
HGLLALMAQAISDSGADIESVETPSKSQSGTEGFVEFKFLLKVKNLDQLN
QIIQNLHSIPYIRKVIRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCGCCCCCCAACCTTCCGCCCCTTACGACCCCCTGACCGCCGAAGC
GCGTACCCTGCTTTTCCATACCGCCTCCTACCTCAAGCCCGAGCAACAGG
CGGAGCTTGAAAAAGCTGTCGCCTATGCGTTTCGCGCCCACGACGGGCAA
ACCCGCAAAAGCGGGGATCCCTACATCACGCATCCGATTGCCGTTGCGAC
GCAGCTCGCCCTTTGGCATATGGACATACAGGGTCTTTGTGCAGGCGTGA
TGCACGACGTATTGGAAGATACGGGCGTGACAAAAGGGGAAATGGCGGCG
GTGTTCGGCAATACTGTTGCCGAGATGGTGGACGGGCTGTCCAAACTCGA
AAAACTCAAATTTGAAGATCATGCGGAACATCAGGCGGAGAGTTTCCGCA
AACTGATTTTGGCGATGACCAAAGATGTGCGCGTCATCGTTGTCAAACTT
GCCGACCGCCTGCACAATATGCGGACGCTCGGTTCGATGCGCCCGGACAA
ACGCCGCCGGATTGCAAGGGAAACCCTTGAAATCTACGCACAGATTGCCA
ACCGCATAGGTCTGAATAATGCGTATCGGGAGCTTCAGGATTTATCGTTC
CAAAACCTGCATCCCAACCGCTACGAGACTTTAAAAAAAGCGATGGACAA
GAGCCGGAAGAACAGGCAGGACGTTGTCGGCAAAGTTTTGCGCGCGTTCG
GCCAGCGGCTGGTAGGCGCGAATATAGAGGCCAAAATCAAAGGCAGGGAA
AAAAACCTGTACGGCATCCATCAGAAAATGATGGCGAAAAAGCTGCGCTT
TGCCGAGGTTATGGATATTTACGGTTTCCGCGTCATTGTCAACAGCATTC
CCGCCTGTTATGCCGCACTCGGCACATTGCACACCCTCTATCAGCCCAAG
CCCGGACGGTTCAAAGACTATATCGCCATTCCGAAAAGCAACGGTTATCA
AAGTCTGCATACGATTTTGGTCGGCCCCTACGGCTTGCCGATTGAAGTTC
AGATACGCACGCGGGAAATGGATGCCGTGGCGGAAGGCGGTATTGTCGGC
CATTGGAGCTATAAATCAGATTCCAAAACGGTCGATCAGGCAGTGCTGCA
CACCAATCAATGGTTGAAAAACATTTTAGACTTGCAGGCAAGCAGCGCCA
ATGCCATTGAGTTTCTCGAACACGTCAAAGTCGATTTGTTTCCGAACGAA
ATCTACATCCTTACTCCGAAAGGAAAAATCCTAACTTTGCCCAAAGGGGC
AACGCCTGTCGATTTTGCTTATGCGGTGCATACCGACATTGGGCATAAAA
CAGTTGCCGCGCGTGTCAATAATGTGATGATGCCGCTGCGTACGAAGCTC
AAAACCGGTGATTCTGTTGAAATTATCACATCCGAACACGCCAAACCCAA
TCCCGCGTGGTTGAATTTCGCCGTGTCCGGCAGGGCGCGCAGTGCCATAC
GCCAATATATTAAAAATCTTAACCGGCACGATGCGGTCGTTTTGGGAGAG
AGCCTCTTACAAAAAGCCTTGTCCAGTTTGCTGCCCAAAGATGTCCTGCT
TTCAGACGGCATCAAAGAAAAATACCTTGCCGATCTCAACGACAAACAGA
CTTCATTTGAGGAAGTGCTGTACAACGTCGGTATGGGGCATACCCTGCCT
GTTTATGTCGCCATGCATATCGCCGAATTGGCAGGGGAGCATTTCGGCAG
CGAGGTCAGGCTCAGTTCCATTAAAGTTGATGGTCAGGAAAGCGGGCATA
TTCATTTTGCAGAGTGCTGCCACCCTGTTCCCGGCGATTCCATCCGTTTG
CTGTTGGTTAAGGGAAAAGGCATGATTATCCATAGGGATACCTGCCCGAC
GTTGTTGAAGTCCGATCCCGAACAGCAGCTGGATGCAGACTGGGAAAATA
TGAACGGGCAGAACTACCGTGTCGGGCTTCAAGTCCAATCGGAAGACAGC
CACGGCCTGTTGGCATTAATGGCGCAAGCGATTTCCGATTCCGGTGCGGA
CATCGAGTCGGTCGAAACACCGTCTAAATCCCAGTCGGGAACGGAAGGTT
TTGTCGAATTCAAATTCTTATTGAAAGTCAAGAATTTGGATCAGTTGAAT
CAGATTATTCAAAATCTGCACAGCATCCCATATATCCGCAAAGTCATCAG
AAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy