Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 tRNA-Ile-1 rRNA-16S-2 rRNA-23S-2 IGR1067 IGR1065 IGR1064 IGR1066 IGR1068 IGR1063 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 spoT, - NG1308 aprt,apt, - NG1311 dfp, - NG1307 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 spoT, - NG1308 aprt,apt, - NG1311 dfp, - NG1307 Type: direct, Name:  - 108 Type: direct, Name:  - 101 Type: direct, Name:  - 113 Type: direct, Name:  - 104 Type: direct, Name:  - 105 Type: direct, Name:  - 109 Type: direct, Name:  - 123 rpoZ, - NG1309 NG1306 gmk,kguA, - NG1310 spoT, - NG1308 aprt,apt, - NG1311 dfp, - NG1307
* Calculated from Protein Sequence

Gene ID: NG1306

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
1263851

Gene Stop:
1263567

Gene Length:
285

Molecular Weight*:
11016

pI*:
10.70

Net Charge*:
10.28

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1306c

Blast Summary:  PSI-Blast Search
No hit found in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1306 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LDTKCRLKPRVSGGIFTKAHQPEEKRRGGLLEAAQRLAEIKNLIRQRHDE
FPQKNPAESIDCFPLRAYSSVLRRCRSGGRTEKYSTECRKYREIS

Gene Nucleotide Sequence:  Sequence Viewer
TTGGATACGAAATGCCGTCTGAAGCCCCGAGTTTCAGGCGGCATATTCAC
AAAGGCGCATCAGCCGGAGGAGAAGAGGAGGGGGGGGTTGTTGGAGGCGG
CGCAGCGTTTGGCGGAGATAAAAAACCTTATCCGACAGCGACATGACGAA
TTTCCCCAAAAAAATCCCGCTGAAAGTATTGACTGTTTTCCCCTGCGGGC
GTATAGTTCGGTTCTTCGCCGCTGCCGAAGCGGCGGACGAACTGAAAAGT
ATAGCACGGAATGTCGGAAATATCGAGAGATATCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy