Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap rRNA-5S-2 rRNA-23S-2 IGR1057 IGR1060 IGR1058 IGR1059 IGR1061 IGR1055 IGR1062 IGR1056 IGR1062.1 IGR1063 NG1296 NG1298 comE, - NG1305 lrp, - NG1294 NG1299 yfcB, - NG1300 NG1297 NG1303 tpn, - NG1302 NG1301 dadX, - NG1295 NG1296 NG1298 comE, - NG1305 lrp, - NG1294 NG1299 yfcB, - NG1300 NG1297 NG1303 tpn, - NG1302 NG1301 dadX, - NG1295 Type: direct, Name:  - 104 Type: direct, Name:  - 108 Type: direct, Name:  - 121 NG1296 NG1298 comE, - NG1305 lrp, - NG1294 NG1299 yfcB, - NG1300 NG1297 NG1303 tpn, - NG1302 NG1301 dadX, - NG1295
* Calculated from Protein Sequence

Gene ID: NG1300

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfcB  

Definition:
adenine specific methylase

Gene Start:
1254954

Gene Stop:
1254046

Gene Length:
909

Molecular Weight*:
33813

pI*:
4.20

Net Charge*:
-35.17

EC:
2.1.1.72  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table

Secondary Evidence:
Bougueleret,L., Schwarzstein,M., Tsugita,A. and Zabeau,M.
Characterization of the genes coding for the Eco RV restriction and modification system of Escherichia coli
Nucleic acids research. 12 (8), 3659-3676 (1984)
M:84221388

Kraev,A.S., Kravets,A.N., Chernov,B.K., Skryabin,K.G. and Baev,A.A.
The EcoRV restriction-modification system: genes, enzymes,
synthetic substrates
Mol. Biol. (Mosk) 19, 236-242 (1985)

Comment:
Oklahoma ID: NGO.1300c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to adenine-specific methylases and hemK family proteins. Residues 13-298 are 49% similar to a probable DNA methylase in Pseudomonas aeruginosa (gb|AAG05067). Residues 4-300 are 50% similar to an adenine-specific methylase in E.coli (gb|AAG57459).

Residues 1-303 are virtually identical to NMB1655 in N.meningitidis ( gb|AAF42004).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 205-266 are 61% similar to a (PROTEIN METHYLTRANSFERASE HEMK) protein domain (PD005237) which is seen in YFCB_ECOLI.

Residues 4-59 are 55% similar to a (ADENINE-SPECIFIC METHYLASE PROTEIN) protein domain (PD033742) which is seen in YFCB_ECOLI.

Residues 82-157 are 50% similar to a (PROTEIN METHYLTRANSFERASE TRANSFERASE HEMK HOMOLOG) protein domain (PD001640) which is seen in YFCB_ECOLI.



Paralogs:  Local Blast Search


NG1300 is paralogously related to NG2015 (protoporphyrinogen oxidase (HemK)) (1e-15).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MVHIMFNQAAQELTTIRDVLRFAVSRFNEAGLFFGHGTDNAHDEAVYLIL
HTLNLPLDMLAPYLDAKLLEAEKEEVLAVIERRAVEHIPAAYLTHQAWQG
EFDFYVDERVIVPRSFIYELLGDGLRPWIEYDELVHNALDLCTGSGCLAI
QMAHHYPDAQIDAVDVSLDALEVAGINIEDYGLEERIQLIHTDLFEGLEG
TYDLIVSNPPYVDAESVGALPEEYLHEPELALGSGADGLDATRQILLNAA
KFLNPKGVLLVEIGHNRDVLEAAYPELPFTWLETSGGDGFVFLLTREQLL
GEE

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTCATATTATGTTTAATCAGGCCGCACAAGAATTGACGACTATCCG
TGATGTTTTACGTTTTGCAGTCAGCCGTTTTAATGAGGCAGGGCTCTTTT
TTGGTCATGGAACAGATAATGCGCATGATGAAGCGGTTTATTTGATTCTG
CATACTTTGAATTTGCCTTTGGATATGCTTGCCCCATATCTTGATGCAAA
ACTCTTGGAAGCTGAAAAAGAGGAAGTGCTGGCGGTTATTGAGCGTCGTG
CTGTCGAACACATTCCTGCCGCTTATTTGACACACCAGGCCTGGCAGGGG
GAGTTTGATTTTTATGTAGATGAACGCGTGATTGTACCGCGCTCTTTTAT
TTATGAATTGCTGGGTGACGGACTTCGACCTTGGATAGAATACGATGAGC
TGGTGCATAATGCTTTGGATCTTTGCACCGGAAGCGGTTGCCTTGCCATT
CAGATGGCGCACCATTATCCTGATGCCCAAATTGATGCGGTTGATGTGAG
TTTGGATGCTTTGGAAGTTGCAGGGATCAATATTGAAGATTATGGTCTGG
AAGAGCGTATTCAGCTTATTCATACCGATTTGTTTGAGGGACTGGAAGGC
ACTTATGATTTGATTGTTTCCAATCCGCCTTATGTGGATGCAGAGTCGGT
TGGGGCTTTGCCTGAGGAATATTTGCACGAACCGGAATTGGCGTTGGGCA
GCGGGGCGGACGGGTTGGATGCCACCAGGCAGATTCTTCTGAATGCGGCA
AAGTTTCTGAATCCTAAAGGTGTATTGCTGGTGGAAATCGGGCATAACAG
GGATGTATTGGAAGCAGCGTATCCGGAGTTGCCTTTTACTTGGTTGGAAA
CCAGCGGGGGCGACGGTTTTGTTTTCCTCTTGACGCGCGAGCAGTTATTG
GGCGAAGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy