Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1052 IGR1057 IGR1060 IGR1058 IGR1059 IGR1055 IGR1053 IGR1056 IGR1054 IGR1051 NG1296 NG1298 NG1293 lrp, - NG1294 dsbB, - NG1292 NG1299 yfcB, - NG1300 NG1297 NG1290 NG1301 NG1291 dadX, - NG1295 NG1296 NG1298 NG1293 lrp, - NG1294 dsbB, - NG1292 NG1299 yfcB, - NG1300 NG1297 NG1290 NG1301 NG1291 dadX, - NG1295 NG1296 NG1298 NG1293 lrp, - NG1294 dsbB, - NG1292 NG1299 yfcB, - NG1300 NG1297 NG1290 NG1301 NG1291 dadX, - NG1295
* Calculated from Protein Sequence

Gene ID: NG1295

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dadX  

Definition:
alanine racemase

Gene Start:
1249801

Gene Stop:
1250856

Gene Length:
1056

Molecular Weight*:
38865

pI*:
6.40

Net Charge*:
-3.76

EC:
5.1.1.1  

Functional Class:
Amino acid biosynthesis; Aspartate family  
Amino acid biosynthesis; Pyruvate family  

Pathway: pathway table
Alanine and aspartate metabolism
D-Alanine metabolism

Secondary Evidence:
Strych,U., Penland,R.L., Jimenez,M., Krause,K.L. and Benedik,M.J.
Characterization of the alanine racemases from two Mycobacteria
FEMS Microbiol. Lett. 196 (2), 93-98 (2001)
MEDLINE: 21167650

Lobocka,M., Hennig,J., Wild,J. and Klopotowski,T.
Organization and expression of the Escherichia coli K-12 dad operon encoding the smaller subunit of D-amino acid dehydrogenase and the catabolic alanine racemase
J. Bacteriol. 176 (5), 1500-1510 (1994)
MEDLINE: 94156858


Comment:
For other 'dad' genes see NG1808 (dadA) and NG0809 (dad).

Oklahoma ID: NGO.1295



Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to alanine racemase sequences. Residues 1-350 are 49% similar to the enzyme from P.aeruginosa (gb|AAG08687).

Residues 1-352 are virtually identical to NMA1906 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0787
COG name: Alanine racemase
Functional Class: M
The phylogenetic pattern of COG0787 is -----q-cEBrhuj--ol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000821 (Alanine racemase) with a combined E-value of 2.9e-76.
    IPB000821A    30-40
    IPB000821B    51-78
    IPB000821C    119-131
    IPB000821D    192-218
    IPB000821E    245-275
    IPB000821F    326-351


ProDom Summary:  Protein Domain Search
Residues 157-341 are 48% similar to a (ALANINE RACEMASE ISOMERASE PYRIDOXAL PHOSPHATE ALR) protein domain (PD003767) which is seen in ALR2_KLEAE.

Residues 27-144 are 42% similar to a (ALANINE RACEMASE ISOMERASE PYRIDOXAL) protein domain (PD186147) which is seen in ALR1_SALTY.



Paralogs:  Local Blast Search

NG1295 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 219 (E-value = 1.2e-90) place NG1295 in the Ala_racemase_N family which is described as Alanine racemase, N-terminal domain (PF01168)
Residues 229 to 351 (E-value = 2.3e-61) place NG1295 in the Ala_racemase_C family which is described as Alanine racemase, C-terminal domain (PF00842)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
44  
60

PDB Hit:
pdb|1BD0|1BD0-A ALANINE RACEMASE COMPLEXED WITH ALANINE 133.0 4e-32
pdb|1EPV|1EPV-A ALANINE RACEMASE WITH BOUND INHIBITOR DERIVED 131.0 2e-31
pdb|1L6F|1L6F-A ALANINE RACEMASE BOUND WITH 131.0 2e-31
pdb|1BD0|1BD0-A A

Gene Protein Sequence:
MRPLNVQIRLGNLRHNYRILKEMHGGKLLAVVKADAYGHGAVRCAFALAD
LADGFAVATIDEGIRLRESGITHPIVLLEGVFEASEYEAVEQYSLWPAVG
NQWQLEALLSRHWKKPVKVWLKMDSGMHRTGFFPHDYTSAYAALKQSEYV
DSIVKFSHFSCADEPESGMTEIQMEAFDLGTKGLEGEESLANSAAILNIP
EARRDWGRAGLALYGISPFGGSDDRLKPVMRLSTRIFGERVLQPHSPIGY
GATFYTSKSTRVGLIACGYADGYPRRAPSNSPVAVDGKLTRVIGRISMDM
MTIELDASQEGLGHEVELWGDTVNINTVAEAAGTIPYELMCNIKRAKFTY
IE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGCCTTTGAACGTGCAGATCAGGTTGGGCAACCTTAGGCACAATTA
TCGGATTTTGAAGGAAATGCACGGAGGCAAGCTGTTGGCGGTAGTGAAGG
CCGACGCATACGGACACGGTGCGGTCAGATGTGCTTTCGCGCTGGCAGAC
TTGGCAGACGGCTTTGCCGTGGCGACAATCGACGAGGGAATCAGGCTGCG
GGAGAGCGGCATTACCCATCCGATTGTCCTTTTAGAAGGCGTATTTGAAG
CATCAGAGTACGAAGCGGTCGAACAATACTCGCTTTGGCCGGCAGTCGGA
AACCAATGGCAGCTTGAGGCTTTGCTTTCCCGCCATTGGAAAAAACCTGT
CAAGGTCTGGTTGAAAATGGATTCGGGAATGCACCGTACCGGATTTTTCC
CTCATGATTACACTTCGGCATATGCGGCATTGAAACAGTCGGAATATGTG
GACAGTATTGTCAAGTTCTCGCATTTCTCCTGTGCGGACGAACCTGAAAG
CGGTATGACGGAAATACAGATGGAAGCATTCGATTTGGGTACGAAAGGGC
TGGAAGGCGAAGAAAGCCTTGCCAATTCGGCAGCTATTTTGAATATCCCC
GAAGCACGCAGGGATTGGGGGCGCGCGGGCTTGGCGTTATACGGCATTTC
CCCGTTCGGAGGCAGCGATGACAGGCTGAAACCCGTGATGAGGCTTTCAA
CCCGTATTTTCGGCGAACGCGTTTTACAGCCGCACTCCCCTATCGGTTAT
GGCGCAACATTTTATACCAGTAAATCTACGCGCGTCGGTCTGATTGCCTG
CGGTTATGCGGACGGTTATCCGCGCCGCGCTCCAAGCAATTCCCCCGTCG
CCGTCGACGGTAAATTGACCCGGGTCATCGGCAGGATCTCTATGGATATG
ATGACTATCGAGCTGGACGCTTCGCAAGAAGGTTTGGGACACGAGGTCGA
ACTGTGGGGCGATACGGTCAATATCAATACCGTTGCCGAAGCGGCCGGAA
CCATCCCTTACGAATTGATGTGCAATATCAAACGTGCAAAATTCACTTAT
ATCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy