Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1044 IGR1046 IGR1045 IGR1043 IGR1042.1 IGR1042.2 IGR1042 IGR1041 NG1281 NG1282 NG1279 serC, - NG1283 NG1280 NG1284 NG1277 nusA, - NG1285 infB, - NG1286 NG1281 NG1282 NG1279 serC, - NG1283 NG1280 NG1284 NG1277 nusA, - NG1285 infB, - NG1286 Type: tandem, Name:  - 60 NG1282 NG1279 serC, - NG1283 NG1280 NG1281 NG1284 NG1277 nusA, - NG1285 infB, - NG1286
* Calculated from Protein Sequence

Gene ID: NG1283

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
serC  

Definition:
phosphoserine aminotransferase

Gene Start:
1236328

Gene Stop:
1235051

Gene Length:
1278

Molecular Weight*:
47974

pI*:
6.30

Net Charge*:
-4.10

EC:
2.6.1.52  

Functional Class:
Amino acid biosynthesis; Serine family  

Pathway: pathway table
Glycine, serine and threonine metabolism
Vitamin B6 metabolism

Primary Evidence:
Morelli,G., Malorny,B., Muller,K., Seiler,A., Wang,J.F., del
Valle,J. and Achtman,M.
Clonal descent and microevolution of Neisseria meningitidis during
30 years of epidemic spread. Mol. Microbiol. 25 (6), 1047-1064 (1997)
M:98010345


Comment:
Oklahoma ID: NGO.1283c

Check for alternative start upstream.

For other 'ser' genes, see NG1335 (serS) and NG1468 (serB).

For other aminotransferases, see NG0082 (avtA), NG0308 (bioA), NG0460, NG0646 (argD), NG1047 (aat), NG1241 (hisC), NG2045 (glmS), NG1329 (tyrB), NG1452 (aspC).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to 3-phosphoserine aminotransferase sequences. Residues 65-426 are 51% similar to the enzyme from P.aeruginosa (gb|AAG06555).

Residues 59-426 are 96% similar to the enzyme from N.meningitidis (gb|AAC32699).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1932
COG name: Phosphoserine aminotransferase
Functional Class:  H,E
The phylogenetic pattern of COG1932 is ----y---eb-h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003248 (Phosphoserine aminotransferase) with a combined E-value of 3.9e-170.
    IPB003248A    66-99
    IPB003248B    117-147
    IPB003248C    154-170
    IPB003248D    207-219
    IPB003248E    237-279
    IPB003248F    302-349
    IPB003248G    359-374
    IPB003248H    389-421


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1283 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 74 to 414 (E-value = 1.3e-52) place NG1283 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
25
transmembrane  
4  
20

PDB Hit:
pdb|1BT4|1BT4-A PHOSPHOSERINE AMINOTRANSFERASE FROM BACILLUS 333.0 3e-92
pdb|1BJO|1BJO-A THE STRUCTURE OF PHOSPHOSERINE AMINOTRANSFERASE 326.0 5e-90
pdb|1BJN|1BJN-A STRUCTURE OF PHOSPHOSERINE AMINOTRANSFERASE FROM324.0 2e-89
pdb|1BT4|1BT4-A PHOS

Gene Protein Sequence:
LYLFVASMIFMFVNQYIDIISRVRAAWNRAEGRYFPSLHKACCKPKIGQV
IVQNQGCIMSLYPIYNFSAGPAVLPEAVLRTAQQEMSDYNGTGFSVMEMS
HRSEMFLSILHHAEQDLRQLLKVPDNYKILFLQGGATTQFNMAAMNLAHG
FRTADAVVTGNWSRIAYEQMSRLTDTEIRLAAHGGEQFDYLDLPPVETWD
VAPDSAFVHFAVNETVNGLQYREVPRLSDGMPPLVCDMSSEILSREFDVA
DYGLIYAGAQKNIGPAGVTVVIVREDLLERCPNDIPDVFNYRSHLNRDGM
YNTPSTYAIYMSGLVFRWLQAQGGVKKIEAVNRLKAQTLYETIDGSGGFY
INDIHPDARSKMNVVFKTASEDLDRRFVLEAELQGLCLLKGYKSVGGMRA
SIYNAMPLEGVRALADFMRDFQRRYG

Gene Nucleotide Sequence:  Sequence Viewer
TTGTATCTATTTGTCGCTAGCATGATTTTTATGTTTGTAAATCAATATAT
TGATATTATTTCCCGTGTTCGGGCGGCATGGAATCGGGCGGAGGGCAGGT
ATTTTCCATCCTTGCACAAAGCCTGCTGCAAGCCTAAAATCGGGCAGGTT
ATTGTTCAGAACCAGGGCTGCATCATGTCTCTTTATCCGATTTACAATTT
TTCCGCCGGCCCTGCCGTGTTGCCTGAAGCTGTGTTGAGGACGGCGCAGC
AGGAAATGTCGGACTACAACGGTACGGGTTTTTCCGTGATGGAAATGAGC
CACCGTTCGGAAATGTTTTTAAGCATCCTGCATCATGCGGAACAGGATTT
GAGGCAGCTTTTGAAAGTGCCTGACAACTATAAGATATTGTTTCTTCAGG
GCGGAGCAACAACCCAATTTAATATGGCAGCCATGAATCTGGCACACGGT
TTCCGCACTGCCGACGCGGTGGTAACGGGCAACTGGAGCCGTATCGCCTA
TGAACAGATGAGCCGTTTGACCGATACGGAAATCCGTTTGGCGGCGCACG
GGGGCGAGCAGTTCGACTATCTCGACCTGCCGCCTGTGGAAACGTGGGAT
GTTGCACCCGATTCGGCGTTTGTCCATTTTGCCGTCAATGAAACTGTCAA
CGGGCTGCAATACCGTGAAGTGCCGCGCCTTTCAGACGGCATGCCGCCGT
TGGTGTGCGATATGTCCAGCGAGATTCTGTCGCGTGAGTTTGATGTTGCC
GACTACGGACTGATTTACGCAGGCGCACAGAAAAACATCGGGCCGGCAGG
AGTTACGGTGGTGATTGTGCGTGAGGATTTGCTCGAGCGTTGTCCGAACG
ATATTCCCGATGTGTTCAACTACCGTTCTCATTTGAACCGCGACGGTATG
TACAACACGCCGTCAACTTACGCGATTTATATGTCGGGGCTGGTGTTCCG
CTGGCTGCAGGCGCAGGGCGGTGTGAAAAAAATTGAAGCGGTCAATCGGC
TGAAGGCGCAAACCTTGTATGAGACGATAGATGGCAGCGGCGGTTTTTAC
ATCAACGATATTCATCCTGATGCGCGCTCCAAAATGAACGTGGTCTTCAA
AACCGCAAGCGAAGACTTGGACCGCCGTTTTGTGCTGGAAGCCGAATTGC
AGGGCTTGTGCCTGTTGAAGGGCTATAAGTCTGTCGGCGGGATGCGCGCC
AGCATTTATAATGCGATGCCGCTTGAAGGCGTGCGGGCTTTGGCAGATTT
TATGCGCGATTTCCAACGGCGTTACGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy