Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1037 IGR1042 IGR1038 IGR1040 IGR1039 IGR1036 IGR1041 NG1279 NG1280 norB, - NG1275 hit, - NG1273 NG1277 pan-1, - NG1276 NG1274 NG1279 NG1280 norB, - NG1275 hit, - NG1273 NG1277 pan-1, - NG1276 NG1274 Type: tandem, Name:  - 60 NG1279 NG1280 norB, - NG1275 hit, - NG1273 NG1277 pan-1, - NG1276 NG1274
* Calculated from Protein Sequence

Gene ID: NG1276

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pan-1  

Definition:
copper-containing dissimilatory nitrite reductase

Gene Start:
1228729

Gene Stop:
1229904

Gene Length:
1176

Molecular Weight*:
40922

pI*:
5.10

Net Charge*:
-10.14

EC:
1.7.99.3  

Functional Class:
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table
Nitrogen metabolism

Primary Evidence:
Hoehn,G.T. and Clark,V.L.
TITLE Isolation and nucleotide sequence of the gene (aniA) encoding the
major anaerobically induced outer membrane protein of Neisseria
gonorrhoeae
JOURNAL Infect. Immun. 60, 4695-4703 (1992)
MEDLINE: 93014187


Comment:
Oklahoma ID: NGO.1276

Check start that could be 54 residues upstream.

Blast Summary:  PSI-Blast Search
NG1276 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 150277, a predicted major anaerobically induced outer membrane protein. This match begins at residue 54 suggesting a difference in start codons.

Several matches to copper-containing nitrite reductase. Residues 54-363 are virtually identical to NMA1887 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 79-250 are 35% similar to a (OXIDOREDUCTASE SIGNAL PRECURSOR COPPER OXIDASE REPEAT) protein domain (PD000573) which is seen in NIR_RHIHE.

Residues 54-251 are 89% similar to a (MAJOR OUTER MEMBRANE PROTEIN) protein domain (PD126332) which is seen in ANIA_NEIGO.

Residues 252-356 are 99% similar to a (SIGNAL NITRITE REDUCTASE PRECURSOR) protein domain (PD007706) which is seen in ANIA_NEIGO.



Paralogs:  Local Blast Search


NG1276 is paralogously related to NG0994 (H.8 outer membrane protein) (8e-05).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
gram negative signal  
1  
17
non-globular  
18  
70
non-globular  
364  
392

PDB Hit:
pdb|1KBV|1KBV-A NITRITE-SOAKED CRYSTAL STRUCTURE OF THE SOLUBLE 593.0 0e+00
pdb|1NIA|1NIA-A MOL_ID: 1; MOLECULE: NITRITE REDUCTASE; CHAIN: 150.0 5e-37
pdb|1GS7|1GS7-A CRYSTAL STRUCTURE OF H254F MUTANT OF ALCALIGENES145.0 2e-35
pdb|1HAU|1HAU-A X-RA

Gene Protein Sequence:
MKRQALAAMIASLFALAACGGEPAAQAPAETPAASAEAASSAAQATAETP
AGELPVIDAVTTHAPEVPPAIDRDYPAKVRVKMETVEKTMKMDDGVEYRY
WTFDGDVPGRMIRVREGDTVEVEFSNNPSSTVPHNVDFHAATGQGGGAAA
TFTAPGRTSTFSFKALQPGLYIYHCAVAPVGMHIANGMYGLILVEPKEGL
PKVDKEFYIVQGDFYTKGKKGAQGLQPFDMDKAVAEQPEYVVFNGHVGAI
AGDNALKAKAGETVRMYVGNGGPNLVSSFHVIGEIFDKVYVEGGKLINEN
VQSTIVPAGGSAIVEFKVDIPGNYTLVDHSIFRAFNKGALGQLKVEGAEN
PEIMTQKLSDTAYAGSGAASAPAASAPAASAPAASASEKSVY

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGCCAAGCATTAGCCGCAATGATTGCTTCCTTATTCGCATTGGC
CGCCTGCGGCGGCGAACCTGCCGCGCAAGCCCCTGCCGAAACCCCTGCCG
CTTCCGCAGAAGCCGCAAGTTCCGCCGCACAAGCTACCGCCGAAACGCCT
GCAGGCGAACTGCCCGTCATCGATGCGGTGACCACCCACGCTCCCGAAGT
ACCTCCCGCAATCGACCGCGACTATCCTGCCAAAGTACGCGTAAAAATGG
AAACCGTCGAAAAAACCATGAAAATGGACGACGGGGTGGAATACCGCTAC
TGGACATTTGACGGCGACGTTCCGGGCCGTATGATCCGCGTACGCGAAGG
CGATACGGTTGAAGTCGAATTCTCCAACAATCCTTCTTCTACCGTTCCGC
ACAACGTCGACTTCCACGCCGCAACCGGTCAGGGCGGCGGTGCAGCCGCG
ACCTTTACCGCCCCGGGCCGCACTTCCACATTCAGCTTCAAAGCCCTGCA
ACCGGGCCTGTACATCTACCACTGCGCCGTCGCGCCGGTCGGTATGCACA
TCGCCAACGGTATGTACGGTCTGATTTTGGTCGAGCCTAAAGAAGGCCTG
CCGAAAGTGGATAAAGAGTTCTACATCGTCCAAGGCGACTTCTACACCAA
AGGCAAAAAAGGCGCGCAAGGCCTGCAACCGTTCGATATGGACAAAGCCG
TTGCCGAACAGCCTGAATACGTCGTATTCAACGGCCACGTAGGCGCTATC
GCCGGCGATAACGCCCTGAAAGCCAAAGCAGGCGAAACCGTGCGTATGTA
CGTCGGTAACGGCGGCCCGAACTTGGTGTCTTCCTTCCACGTCATCGGCG
AAATCTTCGACAAAGTTTATGTTGAAGGCGGCAAACTGATTAACGAAAAC
GTACAAAGCACCATCGTGCCTGCCGGCGGTTCTGCCATCGTCGAATTCAA
AGTCGACATCCCGGGCAACTACACTTTGGTCGACCACTCCATCTTCCGCG
CATTCAACAAAGGCGCGTTGGGGCAATTGAAAGTAGAGGGTGCGGAAAAC
CCTGAAATCATGACTCAAAAATTGAGTGATACCGCTTACGCCGGCAGCGG
CGCGGCTTCTGCCCCTGCTGCTTCCGCACCGGCTGCTTCTGCCCCGGCAG
CCTCTGCATCCGAAAAAAGCGTTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy