Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1037 IGR1038 IGR1035 IGR1040 IGR1039 IGR1036 IGR1041 NG1272 NG1271 norB, - NG1275 hit, - NG1273 NG1277 pan-1, - NG1276 NG1274 NG1272 NG1271 norB, - NG1275 hit, - NG1273 NG1277 pan-1, - NG1276 NG1274 Type: tandem, Name:  - 60 Type: direct, Name:  - 106 NG1272 NG1271 norB, - NG1275 NG1270 NG1270 hit, - NG1273 NG1277 pan-1, - NG1276 NG1274
* Calculated from Protein Sequence

Gene ID: NG1275

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
norB  

Definition:
nitric oxide reductase cytochrome b subunit

Gene Start:
1228211

Gene Stop:
1226103

Gene Length:
2109

Molecular Weight*:
78983

pI*:
6.40

Net Charge*:
-5.82

EC:
1.7.99.7  

Functional Class:
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table
Nitrogen metabolism

Comment:
Oklahoma ID: NGO.1275c

A,C, or D subunits not identified.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to nitric oxide reductase cytochrome b subunit sequences. Residues 1-700 are 38% similar to the protein from Synechocystis (D90917).

Residues 1-703 are 90% similar to NMB1622 in N.meningitidis (gb|AAF41974).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 564-701 are 64% similar to a (NITRIC OXIDE REDUCTASE PLASMID CYTOCHROME B SUBUNIT OF) protein domain (PD024406) which is seen in O30368_ALCEU.

Residues 228-563 are 58% similar to a (HEME OXIDOREDUCTASE COPPER TRANSMEMBRANE) protein domain (PD003369) which is seen in O30375_ALCEU.

Residues 2-227 are 51% similar to a (NITRIC OXIDE REDUCTASE PLASMID CYTOCHROME B SUBUNIT OF) protein domain (PD025755) which is seen in O30368_ALCEU.



Paralogs:  Local Blast Search


NG1275 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
186  
202
transmembrane  
236  
252
transmembrane  
291  
307
transmembrane  
321  
337
transmembrane  
373  
389
transmembrane  
403  
419
non-globular  
447  
521
transmembrane  
451  
467
transmembrane  
472  
488
transmembrane  
506  
522
transmembrane  
546  
562
transmembrane  
590  
606
transmembrane  
629  
645
transmembrane  
682  
698

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTKDDILAGQSAWQSTGGMEVGSILGHGAYQAPDWTADWLHRELSAWLDL
TAQQTYGKKFDEVSPEEQAVLKTRLADEYRNQSRIKEDGSVVISDTRVKA
IESILPYYHGVYGDDPKLQTTREHFAMKNNTLPSQEAREKLFDFFFWTSW
SASTNRPGEVFTYTNNWPHEPLINNVPTTENYMWSFTSVVLLLMGIGLLM
WGYSFLTKHEEVEVPSEDPISKIQLTPSQKALGKYVFLTVALFVVQVLLG
GLTAHYTVEGQGFYGIDEALGFEMSDWFPYALTRTWHIQSAIFWIATGFL
TAGLFLAPIVNGGKDPKFQRAGVNFLYIALFIVVGGSYAGNFFALTHILP
PEFNFWFGHQGYEYLDLGRFWQLLLMVGLLLWLFLMLRCTVSAFKEKGVD
KNLLAIFVASMVGVGVFYAPGLFYGEKSPIAVMEYWRWWVVHLWVEGFFE
VFATAAFAFVFYNMGFVRRSTATASTLAAAAIFMLGGVPGTLHHLYFSGS
TSASMAIGACFSALEVVPLVLLGREAYEHWSYQHLSDWAKRLRWPLMCFV
AVAFWNMIGAGVFGFLINPPISLFYIQGLNTSAVHAHAALFGVYGFLALG
FVLLVARYLKPNARFDDKLMTWGFWLLNGGLVGMIAISLLPVGVIQAYAS
ITHGLWYARSEEFLQMEILDTLRWVRTAPDLIFIGGAICVAIQATKIVFG
RDK

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGAAAGACGATATTTTGGCAGGTCAGTCTGCGTGGCAGAGTACCGG
CGGCATGGAAGTCGGTTCGATTCTGGGTCACGGCGCATATCAGGCTCCGG
ACTGGACGGCCGACTGGCTGCATCGTGAGTTGTCCGCCTGGTTGGATTTG
ACCGCGCAACAGACTTACGGCAAAAAATTCGATGAAGTTTCCCCTGAAGA
ACAAGCCGTTCTGAAAACCCGCTTGGCCGATGAATACCGCAATCAAAGCC
GTATTAAAGAAGACGGCAGCGTCGTCATCAGCGATACGCGCGTGAAAGCC
ATCGAAAGCATCCTGCCTTACTATCACGGCGTTTACGGCGATGATCCCAA
GTTGCAAACCACCCGCGAACACTTTGCAATGAAAAACAACACATTGCCAA
GCCAAGAAGCGCGTGAAAAACTGTTCGACTTCTTCTTCTGGACTTCTTGG
TCTGCTTCGACCAACCGTCCCGGCGAGGTCTTTACCTACACCAACAACTG
GCCGCACGAGCCTTTGATCAACAATGTACCGACTACTGAAAACTACATGT
GGTCGTTTACCAGTGTCGTACTGCTCTTGATGGGCATCGGTTTGTTGATG
TGGGGTTATTCCTTCCTGACCAAACACGAGGAAGTGGAAGTGCCGTCTGA
AGACCCGATTTCCAAAATCCAACTGACCCCTTCGCAAAAAGCATTGGGCA
AATACGTCTTCCTGACGGTCGCCCTGTTTGTGGTACAAGTATTGCTGGGC
GGCCTGACCGCGCACTACACCGTCGAAGGTCAGGGTTTCTACGGCATTGA
CGAGGCGTTGGGCTTTGAAATGTCCGACTGGTTCCCCTACGCCCTGACCC
GTACTTGGCACATCCAATCCGCCATCTTCTGGATTGCAACCGGCTTTTTG
ACGGCAGGTTTGTTCCTCGCGCCGATTGTCAACGGCGGCAAAGATCCCAA
GTTCCAACGTGCAGGCGTGAACTTCCTCTATATCGCCCTCTTCATCGTGG
TCGGCGGTTCTTACGCGGGCAACTTCTTCGCGTTGACGCACATCCTTCCT
CCCGAATTTAACTTCTGGTTCGGACACCAAGGTTACGAATACCTCGATTT
GGGACGTTTCTGGCAACTCCTTTTGATGGTCGGACTGCTGTTGTGGCTGT
TCCTGATGTTGCGCTGCACGGTTTCCGCCTTCAAAGAAAAAGGCGTGGAC
AAAAACTTGCTGGCAATCTTTGTCGCTTCTATGGTCGGCGTGGGCGTGTT
CTACGCACCGGGCCTGTTCTATGGCGAAAAATCCCCGATTGCCGTAATGG
AATACTGGCGTTGGTGGGTGGTCCACCTGTGGGTGGAAGGCTTCTTTGAA
GTATTTGCCACTGCCGCCTTTGCCTTTGTCTTCTACAATATGGGCTTTGT
CCGCCGCAGTACCGCCACTGCCTCCACTTTGGCCGCTGCCGCCATCTTTA
TGTTGGGCGGCGTTCCGGGCACGCTGCACCACCTGTACTTCTCCGGCTCT
ACCTCCGCCTCTATGGCAATCGGCGCCTGCTTCTCCGCTTTGGAAGTCGT
GCCGCTGGTGTTGCTGGGCCGCGAGGCATACGAGCACTGGTCTTACCAAC
ACCTGTCCGACTGGGCGAAACGCCTGCGTTGGCCGCTGATGTGCTTCGTG
GCAGTCGCTTTTTGGAATATGATCGGTGCCGGCGTATTCGGCTTTCTGAT
CAATCCGCCGATTTCCCTGTTCTATATCCAAGGTTTGAACACTTCCGCCG
TTCACGCGCACGCCGCCTTGTTCGGTGTGTACGGTTTCTTGGCATTGGGC
TTCGTATTGTTGGTTGCGCGCTACTTGAAACCGAACGCGCGGTTTGACGA
CAAACTGATGACTTGGGGCTTCTGGCTGCTCAACGGCGGCTTGGTCGGTA
TGATTGCCATCAGCCTGCTGCCTGTCGGCGTGATTCAGGCATACGCCTCT
ATCACGCACGGTTTGTGGTATGCCCGCAGCGAAGAATTCCTGCAAATGGA
AATCCTCGACACCCTGCGCTGGGTACGCACTGCCCCCGACTTAATCTTTA
TCGGCGGTGCAATCTGCGTTGCCATCCAAGCCACTAAAATCGTATTCGGC
CGCGACAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy