Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1023 IGR1021 IGR1025 IGR1020 IGR1021.1 IGR1026 IGR1024 IGR1027 IGR1022 NG1257 pgm,gpmA, - NG1258 pivNG, - NG1262 NG1255.1 NG1255 tpn, - NG1256 NG1261 rsp, - NG1260 parC, - NG1259 alaS, - NG1254 NG1257 pgm,gpmA, - NG1258 pivNG, - NG1262 NG1255.1 NG1255 tpn, - NG1256 NG1261 rsp, - NG1260 parC, - NG1259 alaS, - NG1254 Type: inverse, Name:  - 154 Type: direct, Name:  - 122 Type: inverse, Name:  - 150 Type: inverse, Name:  - 151 Type: inverse, Name:  - 183 pgm,gpmA, - NG1258 pivNG, - NG1262 NG1257 NG1255 tpn, - NG1256 NG1261 rsp, - NG1260 parC, - NG1259 alaS, - NG1254 NG1255.1
* Calculated from Protein Sequence

Gene ID: NG1259

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parC  

Definition:
DNA topoisomerase IV subunit A

Gene Start:
1210528

Gene Stop:
1212828

Gene Length:
2301

Molecular Weight*:
84452

pI*:
9.20

Net Charge*:
6.18

EC:
5.99.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Primary Evidence:
Belland,R.J., Morrison,S.G., Ison,C. and Huang,W.M.
Neisseria gonorrhoeae acquires mutations in analogous regions of
gyrA and parC in fluoroquinolone-resistant isolates. Mol. Microbiol. 14 (2), 371-380 (1994)
M:95131758

Carrick,C.S., Fyfe,J.A.M. and Davies,J.K.
Neisseria gonorrhoeae contains multiple copies of a gene that may
encode a site-specific recombinase and is associated with DNA
rearrangements
Gene 220 (1-2), 21-29 (1998)
M:98440364


Comment:
For other 'par' genes see NG1333 (parE), NG1790 (parA), NG2141 (parB).

Oklahoma ID: NGO.1259

For the B subunit, see NG1333.

Blast Summary:  PSI-Blast Search
NG1259 is 98% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 529410, a predicted topoisomerase IV chain A. See also g1617512.

Residues 15-710 are 46% similar to PARC_ECOLI (gb|AAA69187).

Residues 4-767 are 96% similar to NMA1802 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class:  L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002205 (DNA gyrase/topoisomerase IV, subunit A) with a combined E-value of 5.4e-77.
    IPB002205A    36-54
    IPB002205B    69-104
    IPB002205C    117-131
    IPB002205D    173-194
    IPB002205E    216-225
    IPB002205F    236-245


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1259 is paralogously related to NG0629 (DNA gyrase subunit A) (8e-95).


Pfam Summary:  Pfam Search
Residues 36 to 502 (E-value = 2.3e-251) place NG1259 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
452  
511
non-globular  
717  
767

PDB Hit:
pdb|1AB4|1AB4 59KDA FRAGMENT OF GYRASE A FROM E. COLI 302.0 1e-82
pdb|1BGW|1BGW TOPOISOMERASE RESIDUES 410 - 1202, 73.4 1e-13
pdb|1AB4|1AB4 59KDA FRAGMENT OF GYRASE A FROM E. COLI 632.0 0.000000
pdb|1BGW|1BGW TOP

Gene Protein Sequence:
MNTQPHASHTDSNTLMLGRYAERAYLEYAMSVVKGRALPEVSDGQKPVQR
RILFAMRDMGLTAGAKPVKSARVVGEILGKYHPHGDSSAYEAMVRMAQDF
TLRYPLIDGIGNFGSRDGDGAAAMRYTEARLTPIAELLLSEINQGTVDFM
PNYDGAFDEPLHLPARLPMVLLNGASGIAVGMATEIPSHNLNEVTQAAIA
LLKKPTLETADLMQYIPAPDFAGGGQIITPADELRRIYETGKGSVRVRAR
YEIEKLARGQWRVIVTELPPNANSAKILAEIEEQTNPKPKAGKKQLNQDR
LNTKKLMLDLIDRVRDESDGEHPVRLVFEPKSSRIDTDTFINTLMAQTSL
EGNVSMNLVMMGLDNRPAQKNLKTILQEWLDFRVVTVTRRLKFRLNQVEK
RLHILEGRLKVFLHIDEVIKVIRESDDPKADLMAVFGLTEIQAEDILEIR
LRQLARLEGFKLEKELNELREEQGRLNIFLGDENEKRKLIIKEMQADMKQ
FGDARRTLVEEAGRAVLTQTAADEPITLILSEKGWIRSRAGHNLDLSQTA
FKEGDRLKQTLEGRTVLPVVILDSSGRTYSIDAAEIPGGRGDGVPVSSLI
ELQNGAKPVAMLTGLPEQHYLLSSSGGYGFIAKLGDMVGRVKAGKVVMTA
DSGETVLPPVAVYASSFINPDCKIIAATSQNRALAFPIGELKIMAKGKGL
QIIGLNAGESMTHTAVSSEPEILIESEGRRGAAHKDRLPVALIEAKRGKK
GRLLPISGSLKQLSSPK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACGCAACCGCACGCTTCCCATACCGATTCCAACACGCTGATGCT
CGGCCGATACGCCGAACGCGCCTATCTCGAATACGCCATGAGCGTGGTCA
AAGGCCGCGCGCTGCCTGAAGTTTCAGACGGCCAAAAGCCCGTGCAGCGG
CGCATTTTGTTTGCCATGCGCGATATGGGTTTGACGGCGGGGGCGAAGCC
GGTGAAATCGGCGCGCGTGGTCGGCGAGATTTTGGGTAAATACCATCCGC
ACGGCGACAGTTCCGCCTATGAGGCGATGGTGCGCATGGCTCAGGATTTT
ACCTTGCGCTACCCCTTAATCGACGGCATCGGCAACTTCGGTTCGCGCGA
CGGCGACGGGGCGGCGGCGATGCGTTACACCGAAGCGCGGCTGACGCCGA
TTGCGGAATTGCTGTTGTCCGAAATCAATCAGGGGACGGTGGATTTTATG
CCGAACTACGACGGCGCGTTTGACGAGCCGCTGCACCTTCCCGCCCGCTT
GCCTATGGTGTTGCTCAACGGCGCGTCGGGCATCGCGGTGGGTATGGCGA
CCGAGATTCCGTCGCACAATTTGAACGAAGTCACGCAGGCGGCGATTGCA
CTGTTGAAGAAACCGACGCTGGAAACCGCCGACCTGATGCAATATATTCC
TGCTCCCGATTTTGCCGGCGGCGGTCAAATCATCACGCCGGCGGACGAAT
TGCGCCGTATTTACGAAACCGGCAAGGGCAGCGTGCGCGTGCGTGCGCGT
TATGAAATCGAGAAATTGGCGCGCGGACAGTGGCGCGTCATCGTAACCGA
ACTGCCGCCGAACGCCAACTCCGCCAAAATCCTTGCCGAAATCGAAGAGC
AAACCAACCCGAAACCGAAAGCGGGTAAAAAGCAGCTCAACCAAGACCGG
CTCAATACCAAAAAGCTGATGCTGGATTTAATCGACCGCGTGCGCGACGA
GTCCGACGGCGAACATCCCGTGCGCCTTGTATTTGAACCGAAATCCAGCC
GCATCGATACCGATACCTTCATCAACACGCTGATGGCGCAAACTTCGCTG
GAAGGCAATGTGTCCATGAACTTGGTGATGATGGGTTTGGACAACCGCCC
CGCGCAGAAAAACCTGAAAACGATTTTGCAGGAATGGCTGGATTTCCGCG
TCGTTACCGTAACACGCCGTCTGAAATTCCGTTTAAACCAAGTGGAAAAA
CGGCTGCACATCCTCGAAGGCCGTCTGAAAGTCTTTCTGCACATCGACGA
AGTGATTAAAGTCATCCGCGAATCGGACGACCCGAAAGCCGATTTGATGG
CGGTGTTCGGGCTGACCGAAATCCAAGCCGAAGACATTTTGGAAATCCGC
CTGCGTCAGCTGGCGCGTTTGGAAGGTTTCAAACTCGAAAAAGAATTGAA
CGAATTGCGCGAAGAACAAGGCCGTCTGAATATCTTTTTGGGCGACGAAA
ACGAAAAACGCAAGCTGATTATCAAAGAGATGCAGGCGGACATGAAGCAG
TTCGGCGACGCGCGCCGCACGCTGGTGGAAGAGGCCGGACGCGCCGTGCT
GACACAAACCGCCGCCGACGAACCCATCACGCTGATTTTGTCGGAAAAAG
GCTGGATACGCAGCCGTGCCGGACATAATCTCGATTTGAGCCAAACCGCG
TTCAAAGAAGGCGACCGCCTCAAACAAACCCTTGAAGGCCGCACTGTTTT
ACCCGTCGTCATCCTCGATTCATCGGGCAGAACCTACTCGATCGATGCCG
CCGAAATCCCCGGCGGACGCGGCGACGGCGTACCGGTTTCCTCCTTAATC
GAGTTGCAAAACGGCGCGAAACCCGTCGCGATGTTGACAGGATTGCCGGA
ACAACATTATTTATTATCAAGCAGCGGCGGCTACGGCTTTATCGCCAAGC
TGGGCGATATGGTCGGACGCGTGAAAGCGGGCAAAGTGGTGATGACCGCA
GACAGCGGCGAAACCGTCCTGCCGCCGGTTGCCGTCTATGCCTCCTCGTT
CATCAACCCCGACTGCAAAATCATTGCAGCCACCAGTCAAAACCGCGCCC
TCGCCTTCCCCATCGGCGAATTGAAAATTATGGCGAAAGGCAAAGGACTG
CAAATCATCGGATTAAACGCCGGCGAATCGATGACGCATACCGCCGTTTC
TTCCGAGCCGGAAATCCTGATTGAAAGCGAAGGCAGGCGCGGCGCGGCGC
ACAAAGACCGCCTCCCCGTCGCCCTGATTGAGGCAAAACGCGGCAAAAAA
GGCAGACTGTTGCCCATATCGGGCAGCCTGAAACAGCTTTCTTCCCCCAA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy