Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1023 IGR1021 IGR1025 IGR1020 IGR1021.1 IGR1026 IGR1024 IGR1022 NG1257 pgm,gpmA, - NG1258 NG1255.1 NG1255 tpn, - NG1256 NG1261 rsp, - NG1260 parC, - NG1259 alaS, - NG1254 NG1257 pgm,gpmA, - NG1258 NG1255.1 NG1255 tpn, - NG1256 NG1261 rsp, - NG1260 parC, - NG1259 alaS, - NG1254 pgm,gpmA, - NG1258 NG1257 NG1255 tpn, - NG1256 NG1261 rsp, - NG1260 parC, - NG1259 alaS, - NG1254 NG1255.1
* Calculated from Protein Sequence

Gene ID: NG1258

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgm  gpmA  

Definition:
phosphoglycerate mutase

Gene Start:
1210379

Gene Stop:
1209699

Gene Length:
681

Molecular Weight*:
25914

pI*:
6.50

Net Charge*:
-1.59

EC:
5.4.2.1  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Glycolysis / Gluconeogenesis

Secondary Evidence:
Bond CS, White MF, Hunter WN.
High resolution structure of the phosphohistidine-activated form of Escherichia coli cofactor-dependent phosphoglycerate mutase.
J Biol Chem. 2001 Feb 2;276(5):3247-53.
PMID: 11038361

Comment:
Oklahoma ID: NGO.1258c

Blast Summary:  PSI-Blast Search
Numerous matchews in gapped BLAST to phosphoglycerate mutase sequences. Residues 1-227 are 79% similar to the GpmA enzyme from Pasteurella multocida (gb|AAK03590).

Residues 1-227 are virtually identical to NMA1801 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0588
COG name: Phosphoglycerate mutase 1
Functional Class:  G
The phylogenetic pattern of COG0588 is ----Y---e-rh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001345 (Phosphoglycerate mutase family) with a combined E-value of 2.7e-47.
    IPB001345A    3-32
    IPB001345B    52-64
    IPB001345C    76-107
    IPB001345D    146-164


ProDom Summary:  Protein Domain Search
Residues 92-227 are 76% similar to a (MUTASE PHOSPHOGLYCERATE PGAM) protein domain (PD003480) which is seen in PMG_HAEIN.

Residues 69-156 are 30% similar to a (PHOSPHOGLYCERATE MUTASE PHOSPHOGLYCEROMUTASE PGAM MPGM) protein domain (PD033397) which is seen in PMG2_YEAST.

Residues 1-90 are 73% similar to a (PROTEIN MUTASE PHOSPHOGLYCERATE) protein domain (PD000730) which is seen in PMG_HAEIN.



Paralogs:  Local Blast Search


NG1258 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 225 (E-value = 3.7e-127) place NG1258 in the PGAM family which is described as Phosphoglycerate mutase family (PF00300)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1E58|1E58-A E.COLI COFACTOR-DEPENDENT PHOSPHOGLYCERATE 248.0 6e-67
pdb|1BQ3|1BQ3-D SACCHAROMYCES CEREVISIAE PHOSPHOGLYCERATE MUTASE243.0 2e-65
pdb|1QHF|1QHF-A YEAST PHOSPHOGLYCERATE MUTASE-3PG COMPLEX 243.0 2e-65
pdb|3PGM|3PGM PHOSP

Gene Protein Sequence:
MELVFIRHGQSEWNAKNLFTGWRDVKLSEQGLAEAAAAGKKLKENGYEFD
IAFTSVLTRAIKTCNIVLEESDQLFVPQIKTWRLNERHYGRLQGLDKKQT
AEKYGDEQVRIWRRSYDTLPPLLDKDDAFSAHKDRRYAHLPADVVPDGEN
LKVTLERVLPFWEDQIAPAILSGKRVLVAAHGNSLRALAKHIEGISDEDI
MGLEIPTGQPLVYKLDDNLKVIEKFYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATTGGTATTTATCCGCCACGGACAAAGCGAATGGAACGCGAAAAA
CCTGTTTACAGGCTGGCGCGACGTGAAGCTGAGCGAGCAGGGGCTTGCCG
AGGCCGCCGCCGCCGGTAAAAAACTGAAAGAAAACGGCTATGAGTTCGAC
ATCGCCTTCACATCCGTCCTGACCCGCGCGATTAAGACCTGCAACATCGT
TTTGGAAGAATCCGACCAACTGTTCGTACCGCAAATCAAAACATGGAGGC
TGAACGAACGCCACTACGGCCGACTGCAAGGTTTGGACAAAAAACAAACC
GCCGAAAAATACGGCGACGAGCAAGTCCGCATCTGGCGGCGCAGCTACGA
CACCCTGCCGCCGCTTTTGGACAAAGACGACGCGTTTTCCGCACACAAAG
ACCGTCGCTATGCCCATCTGCCTGCCGATGTCGTACCCGACGGCGAAAAC
CTGAAAGTAACGCTGGAGCGCGTATTACCGTTTTGGGAAGACCAAATCGC
CCCCGCGATTTTGAGCGGCAAACGCGTCTTGGTAGCGGCGCACGGCAACT
CCCTGCGCGCGCTGGCAAAACACATCGAGGGCATTTCCGACGAAGACATC
ATGGGCTTGGAAATCCCGACCGGCCAGCCGCTGGTGTACAAATTAGACGA
CAACCTGAAAGTCATCGAGAAATTTTACCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy