Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1021 IGR1023 IGR1018 IGR1017 IGR1020 IGR1016 IGR1021.1 IGR1024 IGR1019 IGR1022 NG1257 NG1251 pgm,gpmA, - NG1258 potF, - NG1253 NG1255.1 NG1255 tpn, - NG1256 mtrA, - NG1250 NG1252 parC, - NG1259 alaS, - NG1254 NG1257 NG1251 pgm,gpmA, - NG1258 potF, - NG1253 NG1255.1 NG1255 tpn, - NG1256 mtrA, - NG1250 NG1252 parC, - NG1259 alaS, - NG1254 NG1251 pgm,gpmA, - NG1258 potF, - NG1253 NG1257 NG1255 tpn, - NG1256 mtrA, - NG1250 NG1252 parC, - NG1259 alaS, - NG1254 NG1255.1
* Calculated from Protein Sequence

Gene ID: NG1254

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
alaS  

Definition:
alanyl-tRNA synthetase

Gene Start:
1204639

Gene Stop:
1207260

Gene Length:
2622

Molecular Weight*:
95924

pI*:
5.40

Net Charge*:
-20.49

EC:
6.1.1.7  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Alanine and aspartate metabolism
Aminoacyl-tRNA biosynthesis

Secondary Evidence:
Putney,S.D., Melendez,D.L. and Schimmel,P.R.
Cloning, partial sequencing, and in vitro transcription of the gene for alanine tRNA synthetase
J. Biol. Chem. 256 (1), 205-211 (1981)
M:81093926

Miller,W.T., Hill,K.A. and Schimmel,P.
Evidence for a 'cysteine-histidine box' metal-binding site in an
Escherichia coli aminoacyl-tRNA synthetase
Biochemistry 30 (28), 6970-6976 (1991)
M:91299753


Comment:
Oklahoma ID: NGO.1254

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to alanyl-tRNA synthetases, e.g. residues 1-873 are 59% similar to the enzyme from P.aeruginosa (gb|AAG04292).

Residues 1-874 are 91% similar to NMA1788 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0013
COG name: Alanyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0013 is amtKYqVcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003156 (DHHA1 domain) with a combined E-value of 1.2e-204.
    IPB003156A    6-19
    IPB003156B    72-102
    IPB003156C    167-182
    IPB003156D    204-219
    IPB003156E    228-241
    IPB003156F    282-319
    IPB003156G    362-373
    IPB003156H    396-407
    IPB003156I    495-505
    IPB003156J    562-615
    IPB003156K    643-653
    IPB003156L    659-676
    IPB003156C    170-185


ProDom Summary:  Protein Domain Search
Residues 561-695 are 59% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD001534) which is seen in SYA_THIFE.

Residues 3-265 are 79% similar to a (SYNTHETASE AMINOACYL-TRNA ALANYL-TRNA) protein domain (PD002561) which is seen in SYA_ECOLI.

Residues 754-840 are 43% similar to a (SYNTHETASE AMINOACYL-TRNA ALANYL-TRNA ALANINE--TRNA) protein domain (PD005722) which is seen in SYA_THIFE.

Residues 279-428 are 68% similar to a (SYNTHETASE AMINOACYL-TRNA ALANYL-TRNA) protein domain (PD002924) which is seen in SYA_ECOLI.

Residues 453-551 are 48% similar to a (SYNTHETASE AMINOACYL-TRNA ALANYL-TRNA) protein domain (PD002754) which is seen in SYA_HAEIN.



Paralogs:  Local Blast Search


NG1254 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 797 to 867 (E-value = 3.5e-21) place NG1254 in the DHHA1 family which is described as DHHA1 domain (PF02272)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
345  
383
coil-coil  
607  
637
coil-coil  
705  
794
non-globular  
798  
874

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQFKDVFL
GFDKRPYSRATTAQKCVRAGGKHNDLENVGYTARHHTFFEMMGNFSFGDY
FKRDAIHFAWEFLTSPEWLNIPKDKLLATVYAEDDEAYNIWLNEIGMPSE
RIVRIGDNKGAKYASDNFWQMGDTGPCGPCSEIFYDHGKEIWGGIPGSPE
EDGDRWIEIWNCVFMQFNRDEQGNMNPLPKPSVDTGMGLERMAAVMQHVH
SNYEIDLFQDLLKAVARETGAPFSMEEPSLKVIADHIRSCSFLIADGVLP
SNEGRGYVLRRIIRRAVRHGYKLGQSKPFFHKLVADLVQEMGGAYPELKE
KQAQIEEALKNEESRFAQTLETGMALLENALAKGGKTLGGEIIFKLYDTY
GFPYDLTADICRERNIEPDEAGFEREMEAQRARARAAQSFKANAQLPYDG
QDTEFKGYSERQTESKVLALYKDGEQVVELNEGDSGAVVIDFTPFYAESG
GQVGDVGYIFAGENRFEVRDTQKIKAAVFGQFGVQTSGRLKVGDSITAKV
DDEIRNANMRNHSATHLMHKALRDVLGGHVEQKGSLVTAESTRFDISHPQ
AVTAEEIAEVERRVNEAILANVAVNAAIMSMEDAQKTDAMMLFGEKYGDE
VRVLQMGGFSTELCGGTHVSRTGDIGLFKIISEGGIAAGVRRIEAITGLN
ALKWAQEQERLVKDIIAETKAQTEKDVLAKIQAGAAHAKALEKELARAKA
ELAVHAGAKLLDDAKDLGAAKLVAAQIEADAAALRETVTDLTGKSDNAVI
LLAAVNEGKVSLCAGVSKALTGKVKAGDLVKFAAEQVGGKGGGRPDLAQA
GGTDADKLPEMLASAEGWLCQKLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACCTCCGAACTGCGCCAAAAATTCCTAAAATTTTTTGAAACCAA
AGGCCACACCGTCGTCCGCTCTTCCAGCCTCGTGCCGCACGACGACCCGA
CCCTGCTGTTTACCAACGCAGGCATGAACCAGTTTAAAGACGTATTTTTA
GGTTTCGACAAACGCCCGTACAGCCGCGCCACCACCGCGCAAAAATGTGT
ACGCGCAGGCGGCAAGCACAACGACTTGGAAAACGTCGGCTACACCGCCC
GCCACCACACCTTCTTTGAAATGATGGGCAACTTCTCCTTCGGCGATTAC
TTCAAACGCGACGCGATCCACTTCGCTTGGGAGTTTCTCACTTCCCCCGA
ATGGCTCAACATCCCCAAAGACAAACTCTTGGCGACCGTTTACGCAGAAG
ACGACGAAGCCTACAACATCTGGTTGAACGAAATCGGTATGCCGTCTGAA
CGCATCGTCCGCATCGGCGACAACAAAGGCGCGAAATACGCGTCCGACAA
CTTCTGGCAAATGGGCGACACCGGCCCTTGCGGCCCCTGCTCCGAAATTT
TCTACGACCACGGCAAAGAAATCTGGGGCGGCATTCCCGGCAGCCCCGAA
GAAGACGGCGACCGCTGGATTGAAATTTGGAACTGCGTATTCATGCAGTT
CAACCGCGACGAACAAGGCAATATGAATCCGCTGCCCAAGCCGTCCGTCG
ATACCGGTATGGGCTTGGAACGTATGGCCGCCGTGATGCAGCACGTCCAC
AGCAACTACGAAATCGACCTGTTCCAAGACCTGCTCAAAGCCGTTGCCCG
CGAAACCGGCGCGCCGTTCAGTATGGAAGAACCCAGCCTGAAAGTTATCG
CCGACCACATCCGCTCCTGCTCATTCCTGATTGCAGACGGCGTATTGCCT
TCCAACGAAGGACGCGGCTACGTATTGCGCCGCATCATCCGCCGCGCCGT
GCGCCACGGTTACAAACTGGGTCAAAGCAAACCGTTCTTCCACAAACTCG
TTGCCGATTTGGTTCAAGAGATGGGCGGCGCGTATCCTGAATTGAAAGAA
AAACAGGCGCAAATCGAAGAAGCTTTGAAAAACGAAGAAAGCCGTTTTGC
CCAAACTCTGGAAACCGGTATGGCTTTGTTGGAAAACGCGCTGGCCAAAG
GCGGCAAAACACTCGGCGGCGAAATTATCTTCAAACTCTACGATACCTAC
GGCTTCCCATACGACCTGACTGCCGACATCTGCCGCGAACGCAATATCGA
ACCGGACGAAGCAGGCTTCGAGCGCGAAATGGAAGCCCAACGCGCACGCG
CACGCGCCGCCCAAAGCTTCAAAGCCAACGCCCAACTGCCTTACGACGGT
CAAGACACCGAGTTTAAAGGTTATAGCGAACGCCAAACCGAATCCAAAGT
CCTCGCCCTCTACAAAGACGGCGAGCAAGTCGTCGAATTGAACGAAGGCG
ACAGCGGTGCCGTCGTTATCGACTTTACCCCGTTCTATGCAGAATCCGGC
GGCCAAGTCGGCGACGTCGGCTATATCTTCGCAGGCGAAAACCGCTTTGA
AGTACGCGATACCCAAAAAATCAAAGCGGCCGTATTCGGCCAATTCGGCG
TACAAACTTCAGGCCGTCTGAAAGTCGGCGACAGCATTACCGCCAAAGTG
GATGACGAAATCCGCAATGCCAATATGCGCAACCACAGCGCGACCCACCT
GATGCACAAAGCCCTGCGCGACGTATTGGGCGGACACGTCGAACAAAAAG
GCTCTTTGGTTACCGCCGAATCCACCCGTTTCGACATTTCCCATCCCCAA
GCGGTAACTGCCGAAGAAATCGCCGAAGTAGAACGCCGCGTCAACGAAGC
CATCTTGGCCAACGTTGCCGTCAACGCAGCCATTATGAGCATGGAAGACG
CGCAAAAAACCGACGCCATGATGCTCTTCGGCGAAAAATACGGCGACGAA
GTACGCGTACTGCAAATGGGCGGTTTCTCTACCGAATTGTGCGGCGGCAC
ACACGTTTCACGCACCGGCGACATCGGCCTCTTCAAAATCATCAGCGAAG
GCGGTATTGCCGCAGGCGTACGCCGTATCGAAGCCATCACCGGCCTGAAC
GCACTCAAATGGGCGCAAGAGCAAGAGCGTTTGGTAAAAGACATCATTGC
CGAAACCAAAGCCCAAACCGAAAAAGACGTACTGGCGAAAATCCAAGCAG
GCGCGGCACACGCCAAAGCATTGGAAAAAGAATTGGCACGCGCCAAAGCC
GAACTCGCCGTCCACGCAGGCGCCAAACTCTTGGACGACGCAAAAGACCT
GGGCGCGGCCAAACTCGTTGCCGCACAAATCGAAGCCGACGCAGCCGCCC
TGCGCGAAACCGTAACCGACCTGACCGGAAAATCCGACAACGCCGTGATT
CTTTTAGCGGCAGTAAACGAGGGTAAAGTCTCCCTGTGCGCCGGCGTATC
CAAAGCCCTGACCGGAAAAGTCAAAGCAGGAGATCTGGTTAAATTTGCAG
CCGAACAAGTCGGCGGCAAAGGCGGCGGCCGTCCCGACTTGGCGCAAGCC
GGCGGTACGGATGCCGACAAATTGCCCGAAATGCTGGCAAGCGCGGAAGG
TTGGCTTTGTCAGAAATTAAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy