Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 tRNA-Gly-3 tRNA-Gly-2 tRNA-Gly-1 tRNA-Leu-5 IGR1010 IGR1018 IGR1011 IGR1017 IGR1016 IGR1008 IGR1013 IGR1014 IGR1015 IGR1009 IGR1012 NG1249 NG1248 pgsA, - NG1247 NG1251 sohB, - NG1246 potF, - NG1253 NG1244 hisB, - NG1242 mtrA, - NG1250 NG1245 yhaE, - NG1243 NG1252 NG1249 NG1248 pgsA, - NG1247 NG1251 sohB, - NG1246 potF, - NG1253 NG1244 hisB, - NG1242 mtrA, - NG1250 NG1245 yhaE, - NG1243 NG1252 Type: tandem, Name:  - 59 NG1248 pgsA, - NG1247 NG1251 sohB, - NG1246 potF, - NG1253 NG1249 NG1244 hisB, - NG1242 mtrA, - NG1250 NG1245 yhaE, - NG1243 NG1252
* Calculated from Protein Sequence

Gene ID: NG1247

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgsA  

Definition:
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

Gene Start:
1199599

Gene Stop:
1199039

Gene Length:
561

Molecular Weight*:
21262

pI*:
9.80

Net Charge*:
1.99

EC:
2.7.8.5  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Gopalakrishnan,A.S., Chen,Y.C., Temkin,M. and Dowhan,W.
Structure and expression of the gene locus encoding the
phosphatidylglycerophosphate synthase of Escherichia coli
J. Biol. Chem. 261 (3), 1329-1338 (1986)
M:86111778

Usui,M., Sembongi,H., Matsuzaki,H., Matsumoto,K. and Shibuya,I.
Primary structures of the wild-type and mutant alleles encoding the phosphatidylglycerophosphate synthase of Escherichia coli
J. Bacteriol. 176 (11), 3389-3392 (1994)
M:94253011


Comment:
Oklahoma ID: NGO.1247c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to CDP diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase sequences. Residues 50-187 are 55% similar to the enzyme from P.aeruginosa (gb|AAG05972).

Residues 1-187 are 80% similar to NMA1779 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000462 (CDP-alcohol phosphatidyltransferase) with a combined E-value of 1.1e-17.
    IPB000462    51-87


ProDom Summary:  Protein Domain Search
Residues 49-178 are 53% similar to a (TRANSFERASE SYNTHASE PROTEIN 3-PHOSPHATIDYLTRANSFERASE) protein domain (PD001399) which is seen in PGSA_ECOLI.



Paralogs:  Local Blast Search


NG1247 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 41 to 181 (E-value = 3.4e-39) place NG1247 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
32
cleavable N-terminal sequence  
1  
50
transmembrane  
74  
90
transmembrane  
95  
111
transmembrane  
138  
154
transmembrane  
156  
172

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPWNIPIFLTWLRVLLIPVLIVLFYLPFSWFSEEAVNVAAAVIFAVAALT
DWFDGFLARLWKQTSDFGAFLDPVADKLMVAVSLLLLVKLDRTYVLFAMI
IIGREITISALREWMAQMGKRSSVAVATVGKFKTAAQMLAIFFLLLNFPD
FYGFNLVVIGNILMFIASLLTVWSMLYYLKMAWKEIA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTGGAACATCCCCATCTTCCTCACATGGTTGAGGGTCTTGCTCAT
TCCCGTACTGATTGTCCTTTTCTACCTGCCGTTCTCATGGTTTTCAGAAG
AAGCAGTCAATGTTGCCGCCGCCGTCATTTTTGCCGTTGCCGCCTTGACC
GACTGGTTTGACGGATTTTTGGCAAGGTTGTGGAAACAGACTTCCGATTT
CGGCGCATTCCTCGACCCCGTCGCCGACAAGCTGATGGTTGCCGTATCGC
TGCTGCTGCTGGTCAAACTCGACCGGACCTATGTTTTGTTCGCGATGATT
ATCATCGGCAGGGAAATTACCATTTCCGCATTGCGCGAATGGATGGCGCA
AATGGGAAAAAGGAGCAGCGTTGCCGTCGCCACCGTCGGCAAGTTCAAAA
CCGCCGCGCAAATGCTGGCGATTTTCTTTTTGCTGCTGAATTTTCCCGAT
TTTTACGGATTTAATCTTGTTGTTATCGGCAACATATTGATGTTTATCGC
ATCTTTGCTGACAGTCTGGTCGATGCTGTATTATCTGAAAATGGCGTGGA
AAGAAATTGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy