Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 tRNA-Gly-3 tRNA-Gly-2 tRNA-Gly-1 tRNA-Leu-5 IGR1010 IGR1011 IGR1017 IGR1016 IGR1008 IGR1013 IGR1014 IGR1015 IGR1007 IGR1009 IGR1012 NG1249 NG1248 pgsA, - NG1247 NG1251 sohB, - NG1246 NG1244 hisB, - NG1242 mtrA, - NG1250 NG1245 yhaE, - NG1243 NG1252 hisC, - NG1241 NG1249 NG1248 pgsA, - NG1247 NG1251 sohB, - NG1246 NG1244 hisB, - NG1242 mtrA, - NG1250 NG1245 yhaE, - NG1243 NG1252 hisC, - NG1241 Type: tandem, Name:  - 59 NG1248 pgsA, - NG1247 NG1251 sohB, - NG1246 NG1249 NG1244 hisB, - NG1242 mtrA, - NG1250 NG1245 yhaE, - NG1243 NG1252 hisC, - NG1241
* Calculated from Protein Sequence

Gene ID: NG1246

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sohB  

Definition:
possible serine proteinase (SOHB)

Gene Start:
1198285

Gene Stop:
1197236

Gene Length:
1050

Molecular Weight*:
39461

pI*:
7.80

Net Charge*:
1.92

EC:
3.4.21.-  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1246c

Blast Summary:  PSI-Blast Search
Several hits to SOHB-related proteases in gapped BLAST. Residues 1-345 are 55% similar to the SohB in Pasteurella multocida (gb|AAK02669).

Residues 1-350 are virtually identical to NMA1778 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0616
COG name: Periplasmic serine proteases
Functional Class:  N
The phylogenetic pattern of COG0616 is aMtK-QvCEBrHuj---linX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002142 (Peptidase family U7) with a combined E-value of 6.9e-48.
    IPB002142A    139-148
    IPB002142B    172-221
    IPB002142C    277-303


ProDom Summary:  Protein Domain Search
Residues 98-160 are 68% similar to a (POSSIBLE PROTEASE SOHB HYDROLASE) protein domain (PD036979) which is seen in SOHB_ECOLI.

Residues 162-326 are 79% similar to a (PROTEASE IV HYDROLASE PROTEIN ENDOPEPTIDASE) protein domain (PD002897) which is seen in SOHB_HAEIN.



Paralogs:  Local Blast Search


NG1246 is paralogously related to NG1963 (possible secreted proteinase) (2e-12).


Pfam Summary:  Pfam Search
Residues 162 to 313 (E-value = 7.1e-62) place NG1246 in the Peptidase_S49 family which is described as Peptidase family S49 (PF01343)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
24
coil-coil  
44  
103
transmembrane  
192  
208

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MWKEILLNYGIFLLELLTVFGAIALIVLAIVQSKKQSESGSVVLTDFSEN
YKKQRQSFETFFLSEEETKHQEKKEKKKEKAEAKAEKKRLKEGGEKSAET
QKSRLFVLDFDGDLYAHAVESLRHEITAVLLIAKPEDEVLLRLESPGGVV
HGYGLAASQLRRLRERNIPLTVAVDKVAASGGYMMACVADKIVSAPFAVI
GSVGVVAEVPNIHRLLKKHDIDVDVMTAGEFKRTVTFMGENTEKGKQKFR
QELEETHQLFKQFVSENRPGLDIEKIATGEHWFGRQALALNLIDEISTSD
DLLLKAFENKQVIEVKYQEKRSLIQRIGLQAEASVEKLFAKLVNRRADVM


Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGAAAGAAATTTTACTGAATTACGGTATTTTCCTGCTCGAACTGCT
TACCGTGTTCGGCGCAATTGCGCTGATTGTGTTGGCTATCGTACAGAGTA
AGAAACAGTCGGAAAGCGGCAGTGTCGTACTGACAGATTTTTCGGAAAAT
TATAAAAAACAGCGGCAATCGTTTGAAACATTCTTTTTAAGCGAGGAAGA
GACAAAACATCAGGAAAAAAAAGAAAAGAAAAAGGAAAAGGCGGAAGCCA
AAGCAGAGAAAAAGCGTTTGAAGGAGGGCGGGGAGAAATCTGCCGAAACG
CAAAAATCCCGCCTTTTTGTGTTGGATTTTGACGGCGATTTGTATGCACA
CGCCGTAGAATCCTTGCGTCATGAGATTACGGCGGTGCTTTTGATTGCCA
AGCCTGAAGATGAGGTTCTGCTCAGATTGGAAAGTCCGGGCGGCGTGGTT
CACGGTTACGGTTTGGCGGCTTCGCAGCTTAGGCGTTTGCGCGAACGCAA
TATTCCGCTGACCGTCGCCGTCGATAAGGTCGCGGCAAGCGGCGGCTATA
TGATGGCGTGTGTGGCGGATAAAATTGTTTCCGCTCCGTTTGCGGTCATC
GGTTCGGTGGGTGTGGTGGCGGAAGTGCCGAATATCCACCGCCTGTTGAA
AAAACATGATATTGATGTGGATGTGATGACGGCGGGCGAATTTAAGCGCA
CGGTTACTTTTATGGGTGAAAATACGGAAAAGGGCAAACAGAAATTCCGG
CAGGAACTGGAGGAAACGCATCAGTTGTTCAAGCAGTTTGTCAGTGAAAA
CCGCCCCGGGTTGGATATTGAAAAAATAGCGACGGGCGAGCATTGGTTCG
GCCGGCAGGCGTTGGCGTTGAACTTGATTGACGAGATTTCGACCAGTGAT
GATTTGTTGTTGAAAGCGTTTGAAAACAAACAGGTTATCGAAGTGAAATA
TCAGGAGAAGCGAAGCCTGATCCAGCGCATTGGTTTGCAGGCGGAAGCTT
CCGTTGAAAAGTTGTTTGCCAAACTTGTCAACCGGCGAGCGGATGTGATG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy