Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 tRNA-Gly-3 tRNA-Gly-2 tRNA-Gly-1 tRNA-Leu-5 IGR1010 IGR1006 IGR1011 IGR1008 IGR1005 IGR1013 IGR1014 IGR1007 IGR1009 IGR1012 NG1248 pgsA, - NG1247 sohB, - NG1246 NG1244 hisB, - NG1242 hisG, - NG1238 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 NG1248 pgsA, - NG1247 sohB, - NG1246 NG1244 hisB, - NG1242 hisG, - NG1238 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 Type: tandem, Name:  - 59 NG1248 pgsA, - NG1247 sohB, - NG1246 NG1244 hisB, - NG1242 hisG, - NG1238 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240
* Calculated from Protein Sequence

Gene ID: NG1243

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yhaE  

Definition:
3-hydroxyacid dehydrogenase

Gene Start:
1194770

Gene Stop:
1195636

Gene Length:
867

Molecular Weight*:
30236

pI*:
5.50

Net Charge*:
-3.37

EC:
1.1.1.31  

Functional Class:
Unassigned  

Pathway: pathway table
Valine, leucine and isoleucine degradation

Secondary Evidence:
Hawes JW, Harper ET, Crabb DW, Harris RA.
Structural and mechanistic similarities of 6-phosphogluconate and 3-hydroxyisobutyrate dehydrogenases reveal a new enzyme family, the 3-hydroxyacid dehydrogenases.
FEBS Lett. 1996 Jul 8;389(3):263-7.
PMID: 8766712

Comment:
Oklahoma ID: NGO.1243

Note similarities to eukaryotic enzymes.

Blast Summary:  PSI-Blast Search
Several hits to 3-hydroxyacid dehydrogenase and hypothetical proteins. Residues 8-289 are 44% similar to the 3-hydroxyacid dehydrogenase in Helicobacter pylori (gb|AAD06158).

Residues 1-289 are 97% similar to the 3-hydroxyacid dehydrogenase, NMB1584, in N.meningitidis (gb|AAF41937).

COGS Summary:  COGS Search
BeTs to 7 clades of COG2084
COG name: 3-hydroxyisobutyrate dehydrogenase and related proteins
Functional Class:  I
The phylogenetic pattern of COG2084 is --t--q-cEBRh-j-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002204 (3-hydroxyisobutyrate dehydrogenase) with a combined E-value of 2.4e-23.
    IPB002204A    9-22
    IPB002204B    75-98
    IPB002204C    118-135
    IPB002204D    163-198
    IPB002204E    240-249


ProDom Summary:  Protein Domain Search
Residues 69-248 are 45% similar to a (DEHYDROGENASE 6-PHOSPHOGLUCONATE OXIDOREDUCTASE PENTOSE) protein domain (PD001025) which is seen in Q9ZLJ4_BBBBB.

Residues 8-67 are 51% similar to a (OXIDOREDUCTASE REDUCTASE) protein domain (PD119907) which is seen in Q9ZLJ4_BBBBB.



Paralogs:  Local Blast Search


NG1243 is paralogously related to NG1914 (6-phosphogluconate dehydrogenase, decarboxylating (Gnd)) (0.001).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
64  
80
non-globular  
86  
189

PDB Hit:
pdb|1I36|1I36-A MTH1747-CONSERVED HYPOTHETICAL PROTEIN REVEALS 41.8 1e-04
pdb|1PGJ|1PGJ-A X-RAY STRUCTURE OF 6-PHOSPHOGLUCONATE 226.0 3e-60
pdb|1I36|1I36-A MTH1747-CONSERVED HYPOTHETICAL PROTEIN REVEALS 208.0 1e-54
pdb|1PGN|1PGN 6-PHO

Gene Protein Sequence:
MSAETYTQIGWVGLGQMGLPMVTRLLDGGIEVGVYNRSPDKTAPISAKGA
KVYGSTAELVRACPVIFLMVSDYAAVCDILNGVRDGLAGKIIVNMSTISP
TENLAVKALVEAAGGQFAEAPVSGSVGPATNGTLLILFGGSEAVLNPLQK
IFSLVGKKTFHFGDVGKGSGAKLVLNSLLGIFGEAYSEAMLMARQFGIDT
DTIVEAIGGSAMDSPMFQTKKSLWANREFPPAFALKHASKDLNLAVKELE
QAGNTLPAVETVAASYRKAVEAGYGEQDVSGVYLKLAEH

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGCAGAAACATACACACAAATCGGCTGGGTAGGCTTAGGGCAAAT
GGGTCTGCCTATGGTAACGCGGCTCTTGGACGGCGGCATCGAAGTCGGCG
TATACAACCGCTCGCCCGACAAAACTGCCCCCATCTCCGCCAAAGGAGCA
AAAGTTTACGGCAGCACCGCCGAACTCGTCCGCGCCTGCCCCGTCATTTT
CCTGATGGTTTCCGACTATGCCGCCGTGTGCGACATCCTGAACGGAGTCC
GCGACGGATTGGCCGGCAAAATCATCGTCAACATGAGCACCATCTCCCCG
ACCGAAAACCTCGCCGTCAAAGCACTTGTCGAAGCCGCAGGCGGACAGTT
TGCCGAAGCACCCGTTTCCGGATCGGTCGGACCCGCCACCAACGGCACAC
TGCTGATTCTGTTCGGCGGCAGCGAAGCCGTTTTAAACCCGCTGCAAAAA
ATATTTTCCCTTGTCGGCAAAAAAACCTTCCATTTCGGCGATGTCGGCAA
AGGCTCGGGCGCGAAACTCGTCTTGAACTCGCTCTTAGGCATTTTCGGCG
AAGCGTACAGCGAAGCGATGCTGATGGCGCGGCAGTTCGGCATCGATACC
GACACCATCGTCGAAGCCATCGGCGGCTCGGCAATGGACTCGCCTATGTT
TCAAACAAAAAAATCACTATGGGCAAACCGTGAGTTCCCCCCTGCCTTTG
CACTCAAACACGCTTCCAAAGACCTTAACCTCGCCGTCAAAGAGCTTGAA
CAGGCAGGCAACACCCTGCCCGCCGTCGAAACCGTTGCTGCCAGCTACCG
CAAAGCAGTTGAAGCCGGCTACGGCGAACAGGACGTTTCCGGCGTTTACC
TGAAATTGGCAGAACAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy