Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 tRNA-Gly-3 tRNA-Gly-2 tRNA-Gly-1 tRNA-Leu-5 IGR1004 IGR1010 IGR1006 IGR1011 IGR1008 IGR1005 IGR1007 IGR1009 IGR1012 pgsA, - NG1247 sohB, - NG1246 NG1244 NG1237 hisG, - NG1238 hisB, - NG1242 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 pgsA, - NG1247 sohB, - NG1246 NG1244 NG1237 hisG, - NG1238 hisB, - NG1242 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 Type: tandem, Name:  - 59 pgsA, - NG1247 sohB, - NG1246 NG1244 hisG, - NG1238 hisB, - NG1242 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 NG1237
* Calculated from Protein Sequence

Gene ID: NG1242

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisB  

Definition:
imidazoleglycerol-phosphate dehydratase

Gene Start:
1193960

Gene Stop:
1194691

Gene Length:
732

Molecular Weight*:
26890

pI*:
7.20

Net Charge*:
1.23

EC:
4.2.1.19  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Comment:
Oklahoma ID: NGO.1242

Note similarities to eukaryotic enzymes.

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG1241 (hisC), NG0185 (his2).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to imidazoleglycerol-phosphate dehydratase sequences. Residues 49-242 are 75% similar to residues 4-197 of P.aeruginosa (gb|AAG08528).

Residues 1-244 are virtually identical to NMA1772 in N.meningitidis (gb|AAF41936).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0131
COG name: Imidazoleglycerol-phosphate dehydratase
Functional Class:  E
The phylogenetic pattern of COG0131 is amt-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000807 (Imidazoleglycerol-phosphate dehydratase) with a combined E-value of 8.2e-79.
    IPB000807A    49-65
    IPB000807B    76-110
    IPB000807C    128-161
    IPB000807D    195-224
    IPB000807E    231-242
    IPB000807D    99-128


ProDom Summary:  Protein Domain Search
Residues 55-242 are 56% similar to a (IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE IGPD HISTIDINE) protein domain (PD002282) which is seen in HIS7_SYNY3.



Paralogs:  Local Blast Search


NG1242 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 78 to 222 (E-value = 8.6e-87) place NG1242 in the IGPD family which is described as Imidazoleglycerol-phosphate dehydratase (PF00475)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
65

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAKLEKHTGKPKGWLDRKHRERTVPETAAESTGTAETRIAETASAAGCRS
VTVNRNTCETQITVSINLDGSGKSRLDTGVPFLEHMIDQIARHGMIDIDI
SCKGDLHIDDHHTAEDIGITLGQAIRQALGDKKGIRRYGHSYVPLDEALS
RVVIDLSGRPGLVYNIEFTRTLIGRFDVDLFEEFFHGIVNHSMMTLHIDN
LSGKNAHHQAETVFKAFGRALRMAVEHDPRMAGQTPSTKGTLTA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAACTCGAAAAACACACCGGCAAACCCAAAGGCTGGCTCGACAG
AAAACACCGCGAACGCACTGTCCCCGAAACCGCCGCAGAAAGCACCGGAA
CTGCCGAAACCCGAATTGCCGAAACCGCATCTGCTGCCGGCTGCCGCAGC
GTTACCGTCAACCGCAATACCTGCGAAACCCAAATCACCGTCTCCATCAA
CCTCGACGGCAGCGGCAAAAGCAGGCTGGATACCGGCGTTCCCTTCCTCG
AACACATGATCGACCAAATCGCCCGCCACGGCATGATTGACATCGACATC
AGCTGCAAAGGCGACCTGCACATCGACGACCACCACACCGCCGAAGACAT
CGGCATCACACTCGGACAAGCAATCCGGCAGGCACTCGGCGACAAAAAAG
GCATCCGCCGTTACGGACATTCCTACGTCCCGCTCGACGAAGCCCTCAGC
CGCGTCGTCATCGACCTTTCCGGCCGCCCCGGACTCGTGTACAACATCGA
ATTTACCCGCACACTAATCGGACGTTTCGATGTCGATTTGTTTGAAGAAT
TTTTCCACGGCATCGTCAACCACAGCATGATGACCCTGCACATCGACAAC
CTCAGCGGCAAAAACGCCCACCATCAGGCGGAAACCGTATTCAAAGCCTT
CGGGCGCGCCCTGCGTATGGCAGTCGAACACGACCCGAGAATGGCTGGGC
AAACCCCCTCGACCAAAGGCACGCTGACCGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy