Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1010 IGR1006 IGR1011 IGR1008 IGR1005 IGR1007 IGR1009 IGR1003 sohB, - NG1246 NG1244 NG1237 hisG, - NG1238 hisB, - NG1242 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 sohB, - NG1246 NG1244 NG1237 hisG, - NG1238 hisB, - NG1242 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 sohB, - NG1246 NG1244 NG1237 hisG, - NG1238 hisB, - NG1242 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240
* Calculated from Protein Sequence

Gene ID: NG1241

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisC  

Definition:
histidinol-phosphate aminotransferase

Gene Start:
1192687

Gene Stop:
1193763

Gene Length:
1077

Molecular Weight*:
39245

pI*:
7.20

Net Charge*:
0.89

EC:
2.6.1.9  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Tyrosine metabolism

Secondary Evidence:
Limauro,D., Avitabile,A., Cappellano,C., Puglia,A.M. and Bruni,C.B. Cloning and characterization of the histidine biosynthetic gene cluster of Streptomyces coelicolor A3(2). Gene 90 (1), 31-41 (1990)
M:90337345


Comment:
Oklahoma ID: NGO.1241


For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG1240 (hisD), NG0185 (his2), NG1242 (hisB).

For other aminotransferases, see NG0082 (avtA), NG0308 (bioA), NG0460, NG0646 (argD), NG1047 (aat), NG2045 (glmS), NG1283 (serC), NG1329 (tyrB), NG1452 (aspC).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to histidinol-phosphate aminotransferase sequences. Residues 12-354 are 33% similar to the enzyme from A.aeolicus (gb|AAC07813).

Residues 1-358 are 91% similar to NMA1771 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0079
COG name: Histidinol-phosphate aminotransferase
Functional Class:  E
The phylogenetic pattern of COG0079 is AmtkyqvCebRH---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 62-302 are 37% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in O67857_AQUAE.



Paralogs:  Local Blast Search


NG1241 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 72 to 358 (E-value = 4.6e-27) place NG1241 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1FG3|1FG3-A CRYSTAL STRUCTURE OF L-HISTIDINOL PHOSPHATE 115.0 2e-26
pdb|1LC5|1LC5-A CRYSTAL STRUCTURE OF L-THREONINE-O-3-PHOSPHATE 94.4 3e-20
pdb|1GC3|1GC3-A THERMUS THERMOPHILUS ASPARTATE AMINOTRANSFERASE 46.1 1e-05
pdb|1GCK|1GCK-A THER

Gene Protein Sequence:
MKSVRSFIRNDILAMSAYKITDVPPGFAKLDAMESPAHPFEGHEALMREW
RAQLASAPIHLYPNPSGCGLQEALRSAFDIPDCAAVALGNGSDELIQFIT
MLTAKPGAAMLAAEPGFIMYRHNAALYGMDYVGVPLNGDFTLNLPAVLEA
VRKHRPALTFIAYPNNPTGVCFTRAEIEAAIEASDGIVVVDEAYGAFNGD
SFLPQAGRIPNLIVLRTLSKIGFAGLRIGYATGCPEVIGELQKILPPYNM
NQLSLTTAKLALQHYGIISANIDSLKNERERMFAELGKICRLNAFPSQAN
FITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRITIGSSAQNDAV
LDVIRRLYR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATCCGTCCGCTCCTTCATCCGCAACGACATCCTCGCCATGTCCGC
ATACAAAATCACCGATGTTCCGCCCGGTTTTGCCAAACTCGATGCGATGG
AAAGCCCCGCCCATCCTTTTGAGGGGCACGAAGCCCTGATGCGGGAATGG
CGGGCGCAACTGGCATCCGCCCCCATCCACCTCTATCCCAACCCCTCCGG
CTGCGGTTTGCAGGAAGCATTGCGTTCGGCGTTCGACATCCCTGACTGCG
CCGCCGTCGCCTTAGGCAACGGTTCGGACGAACTGATACAGTTCATCACC
ATGCTGACCGCCAAACCCGGCGCGGCAATGTTGGCAGCCGAACCCGGTTT
CATCATGTACCGCCACAACGCCGCGCTGTACGGCATGGATTATGTCGGCG
TTCCACTGAACGGAGATTTCACCCTCAACCTGCCCGCCGTCCTCGAAGCC
GTCAGGAAGCACCGCCCTGCCCTGACCTTTATCGCCTACCCGAACAACCC
GACCGGCGTATGTTTCACGCGTGCCGAAATCGAAGCCGCCATCGAAGCTT
CAGACGGCATCGTCGTCGTCGACGAAGCCTACGGCGCATTCAACGGCGAC
AGCTTCCTGCCGCAGGCGGGCAGGATTCCCAACCTGATAGTCTTACGCAC
CCTCAGCAAAATCGGTTTTGCCGGACTGCGTATCGGTTATGCGACAGGCT
GTCCCGAAGTCATCGGCGAACTGCAAAAAATCCTGCCGCCCTACAATATG
AACCAACTGAGCCTGACCACCGCCAAACTCGCCCTGCAACACTACGGCAT
CATTTCTGCCAACATCGACAGCCTGAAAAACGAACGCGAACGAATGTTCG
CCGAATTGGGCAAAATATGCCGTCTGAACGCCTTTCCAAGTCAGGCAAAC
TTCATTACCATACGCGTACCCGATGCCGATTTGTTGTTTGACACACTCAA
ACAAAACCGCATCCTCGTCAAAAAACTGCACGGCGCACATCCGCTTTTGG
AACACTGCCTGCGCATTACCATAGGCAGCTCCGCACAAAACGATGCCGTC
CTCGACGTTATCCGCCGGCTCTACCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy